Balaenoptera musculus (blue whale): 118900670 Help Entry 118900670         CDS       T09887                                  Name (RefSeq) transmembrane protein 258-like   KO K26502   transmembrane protein 258 Organism bmus  Balaenoptera musculus (blue whale) Pathway bmus00510   N-Glycan biosynthesis bmus00513   Various types of N-glycan biosynthesis bmus04141   Protein processing in endoplasmic reticulum Module bmus_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:bmus00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     118900670    00513 Various types of N-glycan biosynthesis     118900670  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     118900670 SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 TctB Motif Other DBs NCBI-GeneID:  118900670 NCBI-ProteinID:  XP_036719101 UniProt:  A0A8C0CVR3 LinkDB All DBs Position 9 Genome browser AA seq 79 aa AA seqDB search MEFEALSRYTSPVNPAVFPHLTVVLLATGLFFTACFLVYEVTSTASTRDIYKELLIALVA SLFMGFGVLFPLLWVSIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagtttgaggccctgagcagatacaccagcccagtgaacccggctgtcttcccccat ctgaccgtggtgctgttggccactggcctgttcttcaccgcctgcttcttagtgtatgag gtcacctccaccgcatccactcgggatatctacaaagagctcctcatagctttggtggcc tccctcttcatgggctttggagtcctcttcccgctgctctgggtcagcatctacgtatga

DBGET integrated database retrieval system