Brassica napus (rape): 106408993 Help Entry 106408993         CDS       T04128                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism bna  Brassica napus (rape) Pathway bna03420   Nucleotide excision repair bna04120   Ubiquitin mediated proteolysis bna04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:bna00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     106408993    04120 Ubiquitin mediated proteolysis     106408993   09124 Replication and repair    03420 Nucleotide excision repair     106408993  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:bna04121]     106408993    03400 DNA repair and recombination proteins [BR:bna03400]     106408993 Enzymes [BR:bna01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      106408993 Ubiquitin system [BR:bna04121]  Ubiquitin ligases (E3)   UBL E3 ligases    106408993   Multi subunit type E3    SCF complex     Ring finger protein      106408993    Cul2 complex      106408993    Cul3 complex      106408993    Cul4 complex      106408993    Cul7 complex      106408993    Cul8 complex      106408993    Cul9 complex      106408993 DNA repair and recombination proteins [BR:bna03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       106408993     TCR (transcription coupled repair) factors      Cul4-CSA complex       106408993 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  106408993 NCBI-ProteinID:  XP_013705139 UniProt:  A0ABQ7XWM2 A0A078FQ34 LinkDB All DBs Position C9:53833855..53835130 Genome browser AA seq 118 aa AA seqDB search MATLDSDVNMIPAGESSSSVVASSSSKKAKRFEVKKWSAVALWAWDIVVDNCAICRNHIM DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggctacactcgatagcgacgtaaacatgatccctgcgggggaatcctcgagcagcgtc gtggcttcttcgtcgagcaagaaggcgaagagattcgaagtgaagaagtggagcgccgtc gctctttgggcttgggatatcgtcgtcgacaattgcgccatctgcagaaaccacatcatg gatctctgcattgagtgtcaggctaatcaggccagcgctactagtgaggaatgcactgtt gcttggggggtttgcaatcatgctttccactttcactgtatcagcagatggttgaagact cgtcaagtttgtccattggataacagtgagtgggagttccagaagtatggtcactaa

DBGET integrated database retrieval system