Brassica napus (rape): 106425686 Help Entry 106425686         CDS       T04128                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism bna  Brassica napus (rape) Pathway bna03420   Nucleotide excision repair bna04120   Ubiquitin mediated proteolysis bna04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:bna00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     106425686    04120 Ubiquitin mediated proteolysis     106425686   09124 Replication and repair    03420 Nucleotide excision repair     106425686  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:bna04121]     106425686    03400 DNA repair and recombination proteins [BR:bna03400]     106425686 Enzymes [BR:bna01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      106425686 Ubiquitin system [BR:bna04121]  Ubiquitin ligases (E3)   UBL E3 ligases    106425686   Multi subunit type E3    SCF complex     Ring finger protein      106425686    Cul2 complex      106425686    Cul3 complex      106425686    Cul4 complex      106425686    Cul7 complex      106425686    Cul8 complex      106425686    Cul9 complex      106425686 DNA repair and recombination proteins [BR:bna03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       106425686     TCR (transcription coupled repair) factors      Cul4-CSA complex       106425686 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  106425686 NCBI-ProteinID:  XP_013721854 UniProt:  A0A078I4Y8 LinkDB All DBs Position C2:complement(4294377..4295592) Genome browser AA seq 119 aa AA seqDB search MASLDSDVTMVPAGESSSSVAPSSSSTKKAKRFEVKKWSAVALWAWDIVVDNCAICRNHI MDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggcttcgctcgattccgacgtcaccatggttcccgcaggagaatcctcaagcagcgtc gccccatcgtcgtcgtccaccaagaaggcgaagagattcgaagttaagaagtggagcgcc gtggctctctgggcttgggatatcgttgttgataattgcgctatctgcagaaaccacatc atggatctgtgtattgaatgtcaggctaatcaggccagtgctacgagtgaggagtgcact gttgcttggggagtttgcaaccacgccttccactttcactgcatcagcagatggctaaag actcgtcaagtttgtccattggataacagtgagtgggagttccagaagtatggtcactaa

DBGET integrated database retrieval system