Brassica napus (rape): 125590138 Help Entry 125590138         CDS       T04128                                  Name (RefSeq) transmembrane protein 258-like   KO K26502   transmembrane protein 258 Organism bna  Brassica napus (rape) Pathway bna00510   N-Glycan biosynthesis bna00513   Various types of N-glycan biosynthesis bna04141   Protein processing in endoplasmic reticulum Module bna_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:bna00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     125590138    00513 Various types of N-glycan biosynthesis     125590138  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     125590138 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 LapA_dom DUF6338 Motif Other DBs NCBI-GeneID:  125590138 NCBI-ProteinID:  XP_048619174 LinkDB All DBs Position C7:complement(51513014..51514182) Genome browser AA seq 76 aa AA seqDB search MAATPITSPIPVAMYPTLSVVTLAIGLVITAFFFIYEATSSRKNRSLGKELAAAAVASVF LGFGSLFLLLASGVYV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggctgcgacaccgattacgagtccgattccggtggcgatgtacccgactctgtcggtg gtcactctagcgattggcctcgtcatcacagctttcttcttcatctatgaagctacatca tccaggaaaaaccgtagcctcgggaaggagctcgcggctgcagcagtagcatctgttttc ttgggttttggatcgttgtttttgctacttgctagtggtgtttatgtctga

DBGET integrated database retrieval system