Bactrocera oleae (olive fruit fly): 106616290 Help Entry 106616290         CDS       T07646                                  Symbol kud Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism bod  Bactrocera oleae (olive fruit fly) Pathway bod00510   N-Glycan biosynthesis bod00513   Various types of N-glycan biosynthesis bod04141   Protein processing in endoplasmic reticulum Module bod_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:bod00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     106616290 (kud)    00513 Various types of N-glycan biosynthesis     106616290 (kud)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     106616290 (kud) SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF4010 DUF6512 Motif Other DBs NCBI-GeneID:  106616290 NCBI-ProteinID:  XP_036216362 LinkDB All DBs Position 6:complement(19033006..19033336) Genome browser AA seq 79 aa AA seqDB search MESMQRYVSPVNPAVFPHLATVLLTIGTFFTAWFFVFVVSRPKNSKEHTLFKELSISFCA SIFLGFGVVFLMLSVGIYI NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaaagtatgcaacggtatgtttcacccgtaaatccagctgtgtttccacacctagct acggtgctgctgacaattggtacttttttcaccgcctggtttttcgtatttgtggtatca cgaccaaagaattcaaaggagcatactctatttaaagaactttcaattagtttttgcgct tcaatatttctaggtttcggagtagtttttctaatgctttcagttggtatatacatataa

DBGET integrated database retrieval system