Bactrocera oleae (olive fruit fly): 106621760 Help Entry 106621760         CDS       T07646                                  Name (RefSeq) RING-box protein 1A   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism bod  Bactrocera oleae (olive fruit fly) Pathway bod03420   Nucleotide excision repair bod04120   Ubiquitin mediated proteolysis bod04141   Protein processing in endoplasmic reticulum bod04310   Wnt signaling pathway bod04341   Hedgehog signaling pathway - fly bod04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:bod00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     106621760    04120 Ubiquitin mediated proteolysis     106621760   09124 Replication and repair    03420 Nucleotide excision repair     106621760  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     106621760    04341 Hedgehog signaling pathway - fly     106621760    04350 TGF-beta signaling pathway     106621760  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:bod04121]     106621760    03400 DNA repair and recombination proteins [BR:bod03400]     106621760 Enzymes [BR:bod01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      106621760 Ubiquitin system [BR:bod04121]  Ubiquitin ligases (E3)   UBL E3 ligases    106621760   Multi subunit type E3    SCF complex     Ring finger protein      106621760    Cul2 complex      106621760    Cul3 complex      106621760    Cul4 complex      106621760    Cul7 complex      106621760    Cul8 complex      106621760    Cul9 complex      106621760 DNA repair and recombination proteins [BR:bod03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       106621760     TCR (transcription coupled repair) factors      Cul4-CSA complex       106621760 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  106621760 NCBI-ProteinID:  XP_014096209 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MEVDEEDFEVPTSSSKGEKKRFDVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggaggtcgacgaggaagatttcgaggtaccaacttcaagtagcaaaggcgaaaagaag cgtttcgatgtgaaaaagtggaatgccgtcgctttatgggcctgggatattgttgtagac aattgcgctatttgtcgtaaccatataatggatttgtgtatagaatgtcaggccaatcag gcgtctgctaccagcgaggaatgtactgttgcgtggggcgtctgcaatcatgcttttcat tttcattgcatctcacgttggttaaaaacccgacaggtgtgtccattggacaacagggaa tgggagttccagaaatatggccactag

DBGET integrated database retrieval system