Bactrocera oleae (olive fruit fly): 106627011 Help Entry 106627011         CDS       T07646                                  Name (RefSeq) RING-box protein 1-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism bod  Bactrocera oleae (olive fruit fly) Pathway bod03420   Nucleotide excision repair bod04120   Ubiquitin mediated proteolysis bod04141   Protein processing in endoplasmic reticulum bod04310   Wnt signaling pathway bod04341   Hedgehog signaling pathway - fly bod04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:bod00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     106627011    04120 Ubiquitin mediated proteolysis     106627011   09124 Replication and repair    03420 Nucleotide excision repair     106627011  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     106627011    04341 Hedgehog signaling pathway - fly     106627011    04350 TGF-beta signaling pathway     106627011  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:bod04121]     106627011    03400 DNA repair and recombination proteins [BR:bod03400]     106627011 Enzymes [BR:bod01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      106627011 Ubiquitin system [BR:bod04121]  Ubiquitin ligases (E3)   UBL E3 ligases    106627011   Multi subunit type E3    SCF complex     Ring finger protein      106627011    Cul2 complex      106627011    Cul3 complex      106627011    Cul4 complex      106627011    Cul7 complex      106627011    Cul8 complex      106627011    Cul9 complex      106627011 DNA repair and recombination proteins [BR:bod03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       106627011     TCR (transcription coupled repair) factors      Cul4-CSA complex       106627011 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 Motif Other DBs NCBI-GeneID:  106627011 NCBI-ProteinID:  XP_014102437 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MTTNQMEVDDTDTEEFQDIEEFSDEAPSCSNTQPQSKRFVVKKWQAQALWSWDVAVDNCA ICRNQIMDLCIECQANPLCSSTKEECTVAWGACNHAFHFHCISRWLKTRQVCPLDNKEWD YQKYGR NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgacaaccaatcagatggaagtggatgacacggacaccgaagaattccaagacatcgaa gagttctccgatgaggcaccctcttgcagcaatacgcagccacaatcgaaacgattcgta gtaaaaaagtggcaggcccaggcgctctggtcatgggatgtggccgtggacaattgcgcc atttgtcgcaaccaaattatggatttgtgcattgagtgccaggcgaacccgctgtgctcg agcaccaaggaggagtgcactgtggcttggggtgcatgcaaccacgcctttcattttcac tgcatttcgcgttggctcaagacccgtcaggtgtgtccgctggacaacaaagagtgggat tatcaaaagtacggacgttag

DBGET integrated database retrieval system