Bactrocera oleae (olive fruit fly): 118681423 Help Entry 118681423         CDS       T07646                                  Symbol Roc1a Name (RefSeq) RING-box protein 1A   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism bod  Bactrocera oleae (olive fruit fly) Pathway bod03420   Nucleotide excision repair bod04120   Ubiquitin mediated proteolysis bod04141   Protein processing in endoplasmic reticulum bod04310   Wnt signaling pathway bod04341   Hedgehog signaling pathway - fly bod04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:bod00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     118681423 (Roc1a)    04120 Ubiquitin mediated proteolysis     118681423 (Roc1a)   09124 Replication and repair    03420 Nucleotide excision repair     118681423 (Roc1a)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     118681423 (Roc1a)    04341 Hedgehog signaling pathway - fly     118681423 (Roc1a)    04350 TGF-beta signaling pathway     118681423 (Roc1a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:bod04121]     118681423 (Roc1a)    03400 DNA repair and recombination proteins [BR:bod03400]     118681423 (Roc1a) Enzymes [BR:bod01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      118681423 (Roc1a) Ubiquitin system [BR:bod04121]  Ubiquitin ligases (E3)   UBL E3 ligases    118681423 (Roc1a)   Multi subunit type E3    SCF complex     Ring finger protein      118681423 (Roc1a)    Cul2 complex      118681423 (Roc1a)    Cul3 complex      118681423 (Roc1a)    Cul4 complex      118681423 (Roc1a)    Cul7 complex      118681423 (Roc1a)    Cul8 complex      118681423 (Roc1a)    Cul9 complex      118681423 (Roc1a) DNA repair and recombination proteins [BR:bod03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       118681423 (Roc1a)     TCR (transcription coupled repair) factors      Cul4-CSA complex       118681423 (Roc1a) SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  118681423 NCBI-ProteinID:  XP_036221725 LinkDB All DBs Position 5:complement(48754578..48755473) Genome browser AA seq 108 aa AA seqDB search MEVDEEDFEVPTSSSKGEKKRFDVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggaggtcgacgaggaagatttcgaggtaccaacttcaagtagcaaaggcgaaaagaag cgtttcgatgtgaaaaagtggaatgccgtcgctttatgggcctgggatattgttgtagac aattgcgctatttgtcgtaaccatataatggatttgtgtatagaatgtcaggccaatcag gcgtctgctaccagcgaggaatgtactgttgcgtggggcgtctgcaatcatgcttttcat tttcattgcatctcacgttggttaaaaacccgacaggtgtgtccattggacaacagggaa tgggagttccagaaatatggccactaa

DBGET integrated database retrieval system