Brassica oleracea (wild cabbage): 106316076 Help Entry 106316076         CDS       T04124                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism boe  Brassica oleracea (wild cabbage) Pathway boe03420   Nucleotide excision repair boe04120   Ubiquitin mediated proteolysis boe04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:boe00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     106316076    04120 Ubiquitin mediated proteolysis     106316076   09124 Replication and repair    03420 Nucleotide excision repair     106316076  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:boe04121]     106316076    03400 DNA repair and recombination proteins [BR:boe03400]     106316076 Enzymes [BR:boe01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      106316076 Ubiquitin system [BR:boe04121]  Ubiquitin ligases (E3)   UBL E3 ligases    106316076   Multi subunit type E3    SCF complex     Ring finger protein      106316076    Cul2 complex      106316076    Cul3 complex      106316076    Cul4 complex      106316076    Cul7 complex      106316076    Cul8 complex      106316076    Cul9 complex      106316076 DNA repair and recombination proteins [BR:boe03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       106316076     TCR (transcription coupled repair) factors      Cul4-CSA complex       106316076 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 Motif Other DBs NCBI-GeneID:  106316076 NCBI-ProteinID:  XP_013609396 UniProt:  A0A0D3EDS1 LinkDB All DBs Position C9:45113593..45114840 Genome browser AA seq 118 aa AA seqDB search MATLDSDVNMIPAGESSSSVVASSSSKKAKRFEVKKWSAVALWAWDIVVDNCAICRNHIM DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggccacactcgatagcgacgtaaacatgatccctgcgggggaatcctcgagcagcgtc gtggcttcttcgtcgagcaagaaggcgaagagattcgaagtgaagaagtggagcgccgtg gctctttgggcttgggatatcgtcgtcgacaattgcgccatctgcagaaaccacatcatg gatctctgcattgagtgtcaggctaatcaggccagcgctactagtgaggaatgcactgtt gcttggggggtttgcaatcatgctttccactttcactgcatcagcagatggttgaagact cgtcaagtttgtccattggataacagtgagtgggagttccagaagtatggtcactaa

DBGET integrated database retrieval system