Bos mutus (wild yak): 102267095 Help Entry 102267095         CDS       T02919                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism bom  Bos mutus (wild yak) Pathway bom03050   Proteasome bom04060   Cytokine-cytokine receptor interaction bom04066   HIF-1 signaling pathway bom04217   Necroptosis bom04350   TGF-beta signaling pathway bom04380   Osteoclast differentiation bom04612   Antigen processing and presentation bom04630   JAK-STAT signaling pathway bom04650   Natural killer cell mediated cytotoxicity bom04657   IL-17 signaling pathway bom04658   Th1 and Th2 cell differentiation bom04659   Th17 cell differentiation bom04660   T cell receptor signaling pathway bom04940   Type I diabetes mellitus bom05140   Leishmaniasis bom05142   Chagas disease bom05143   African trypanosomiasis bom05144   Malaria bom05145   Toxoplasmosis bom05146   Amoebiasis bom05152   Tuberculosis bom05160   Hepatitis C bom05164   Influenza A bom05168   Herpes simplex virus 1 infection bom05200   Pathways in cancer bom05235   PD-L1 expression and PD-1 checkpoint pathway in cancer bom05321   Inflammatory bowel disease bom05322   Systemic lupus erythematosus bom05323   Rheumatoid arthritis bom05330   Allograft rejection bom05332   Graft-versus-host disease bom05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bom00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     102267095 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     102267095 (IFNG)    04630 JAK-STAT signaling pathway     102267095 (IFNG)    04066 HIF-1 signaling pathway     102267095 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102267095 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102267095 (IFNG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     102267095 (IFNG)    04612 Antigen processing and presentation     102267095 (IFNG)    04660 T cell receptor signaling pathway     102267095 (IFNG)    04658 Th1 and Th2 cell differentiation     102267095 (IFNG)    04659 Th17 cell differentiation     102267095 (IFNG)    04657 IL-17 signaling pathway     102267095 (IFNG)   09158 Development and regeneration    04380 Osteoclast differentiation     102267095 (IFNG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102267095 (IFNG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102267095 (IFNG)   09172 Infectious disease: viral    05160 Hepatitis C     102267095 (IFNG)    05164 Influenza A     102267095 (IFNG)    05168 Herpes simplex virus 1 infection     102267095 (IFNG)   09171 Infectious disease: bacterial    05152 Tuberculosis     102267095 (IFNG)   09174 Infectious disease: parasitic    05146 Amoebiasis     102267095 (IFNG)    05144 Malaria     102267095 (IFNG)    05145 Toxoplasmosis     102267095 (IFNG)    05140 Leishmaniasis     102267095 (IFNG)    05142 Chagas disease     102267095 (IFNG)    05143 African trypanosomiasis     102267095 (IFNG)   09163 Immune disease    05322 Systemic lupus erythematosus     102267095 (IFNG)    05323 Rheumatoid arthritis     102267095 (IFNG)    05321 Inflammatory bowel disease     102267095 (IFNG)    05330 Allograft rejection     102267095 (IFNG)    05332 Graft-versus-host disease     102267095 (IFNG)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102267095 (IFNG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102267095 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:bom03051]     102267095 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bom04052]     102267095 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:bom00536]     102267095 (IFNG) Proteasome [BR:bom03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     102267095 (IFNG) Cytokines and neuropeptides [BR:bom04052]  Cytokines   Interferons    102267095 (IFNG) Glycosaminoglycan binding proteins [BR:bom00536]  Heparan sulfate / Heparin   Cytokines    102267095 (IFNG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IFN-gamma API5 DnaGprimase_HBD Spore_III_AB rva_4 Motif Other DBs NCBI-GeneID:  102267095 NCBI-ProteinID:  XP_005909111 UniProt:  L8HQQ5 LinkDB All DBs Position 5:complement(26836179..26840907) Genome browser AA seq 166 aa AA seqDB search MKYTSYFLALLLCVLLGFSGSYGQGQFFREIENLKEYFNASNPDVAKGGPLFSEILKNWK DESDKKIIQSQIVSFYFKLFENLKDNQVIQRSMDIIKQDMFQKFLNGSSEKLEDFKKLIQ IPVDDLQIQRKAINELIKVMNDLSPKSNLRKRKRSQNLFRGRRASM NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atgaaatatacaagctatttcttagctttactgctctgtgtgcttttgggtttttctggt tcttatggccagggccaattttttagagaaatagaaaacttaaaggagtattttaatgca agtaacccagatgtagctaagggtgggcctctcttctcagaaattttgaagaattggaaa gatgaaagtgacaaaaaaattattcagagccaaattgtctccttctacttcaaactcttt gaaaacctcaaagataaccaggtcattcaaaggagcatggatatcatcaagcaagacatg tttcagaagttcttgaatggcagctctgagaaactggaggacttcaaaaagctgattcaa attccggtggatgatctgcagatccagcgcaaagccataaatgaactcatcaaagtgatg aatgacctgtcgccaaaatctaacctcagaaagcggaagagaagtcagaatctctttcga ggccggagagcatcaatgtaa

DBGET integrated database retrieval system