Bos mutus (wild yak): 102270457 Help Entry 102270457         CDS       T02919                                  Symbol IL10 Name (RefSeq) interleukin-10   KO K05443   interleukin 10 Organism bom  Bos mutus (wild yak) Pathway bom04060   Cytokine-cytokine receptor interaction bom04061   Viral protein interaction with cytokine and cytokine receptor bom04068   FoxO signaling pathway bom04148   Efferocytosis bom04625   C-type lectin receptor signaling pathway bom04630   JAK-STAT signaling pathway bom04660   T cell receptor signaling pathway bom04672   Intestinal immune network for IgA production bom05133   Pertussis bom05135   Yersinia infection bom05140   Leishmaniasis bom05142   Chagas disease bom05143   African trypanosomiasis bom05144   Malaria bom05145   Toxoplasmosis bom05146   Amoebiasis bom05150   Staphylococcus aureus infection bom05152   Tuberculosis bom05310   Asthma bom05320   Autoimmune thyroid disease bom05321   Inflammatory bowel disease bom05322   Systemic lupus erythematosus bom05330   Allograft rejection Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102270457 (IL10)    04068 FoxO signaling pathway     102270457 (IL10)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102270457 (IL10)    04061 Viral protein interaction with cytokine and cytokine receptor     102270457 (IL10)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     102270457 (IL10)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102270457 (IL10)    04660 T cell receptor signaling pathway     102270457 (IL10)    04672 Intestinal immune network for IgA production     102270457 (IL10)  09160 Human Diseases   09171 Infectious disease: bacterial    05135 Yersinia infection     102270457 (IL10)    05133 Pertussis     102270457 (IL10)    05150 Staphylococcus aureus infection     102270457 (IL10)    05152 Tuberculosis     102270457 (IL10)   09174 Infectious disease: parasitic    05146 Amoebiasis     102270457 (IL10)    05144 Malaria     102270457 (IL10)    05145 Toxoplasmosis     102270457 (IL10)    05140 Leishmaniasis     102270457 (IL10)    05142 Chagas disease     102270457 (IL10)    05143 African trypanosomiasis     102270457 (IL10)   09163 Immune disease    05310 Asthma     102270457 (IL10)    05322 Systemic lupus erythematosus     102270457 (IL10)    05320 Autoimmune thyroid disease     102270457 (IL10)    05321 Inflammatory bowel disease     102270457 (IL10)    05330 Allograft rejection     102270457 (IL10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bom04052]     102270457 (IL10)    00536 Glycosaminoglycan binding proteins [BR:bom00536]     102270457 (IL10) Cytokines and neuropeptides [BR:bom04052]  Cytokines   Interleukins    102270457 (IL10) Glycosaminoglycan binding proteins [BR:bom00536]  Heparan sulfate / Heparin   Cytokines    102270457 (IL10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL10 IL22 CLZ Motif Other DBs NCBI-GeneID:  102270457 NCBI-ProteinID:  XP_005891712 UniProt:  L8IV62 LinkDB All DBs Position 16:complement(3973822..3978488) Genome browser AA seq 179 aa AA seqDB search MPSSSALLCCLVFLAGVAASRDASTLSDSSCIHFPTSLPHMLRELRAAFGRVKTFFQMKD QLHSLLLTQSLLDDFKGYLGCQALSEMIQFYLEEVMPKAENHGPDIKEHVNSLGEKLKTL RLRLRRCHRFLPCENKSKAVEKVKRVFSELQERGVYKAMSEFDIFINYIETYVTTKMQK NT seq 540 nt NT seq  +upstreamnt  +downstreamnt atgcccagcagctcagccctgctctgttgcctggtcttcctggctggggtggcagccagc cgagatgcgagcaccctgtctgacagcagctgtatccacttcccaaccagcctgccccac atgctgcgggagctccgagctgccttcggcagggtgaagactttctttcaaatgaaggac caactgcacagcttactgttgacccagtctctgctggatgactttaagggttacctgggt tgccaagccttgtcggaaatgatccagttttacctggaagaggtgatgccaaaggctgag aaccacgggcctgacatcaaggagcacgtgaactcgctgggggagaagctgaagaccctc cggctccggctgcggcgctgtcatcgctttctgccctgcgaaaacaagagcaaggcggtg gagaaggtgaagagagtcttcagtgagctccaagagaggggtgtctacaaagccatgagt gagtttgacatcttcatcaactacatagaaacctacgtgacaacgaagatgcaaaagtga

DBGET integrated database retrieval system