Bos mutus (wild yak): 102274488 Help Entry 102274488         CDS       T02919                                  Name (RefSeq) thymosin beta-4-like   KO K05764   thymosin, beta 4 Organism bom  Bos mutus (wild yak) Pathway bom04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:bom00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102274488  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:bom04812]     102274488 Cytoskeleton proteins [BR:bom04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Thymosin      102274488 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thymosin Qua1 Motif Other DBs NCBI-GeneID:  102274488 NCBI-ProteinID:  XP_070229054 LinkDB All DBs Position 6:complement(79338122..79338482) Genome browser AA seq 44 aa AA seqDB search MSDKPDMAEIEKFDKSKLKKMEMQEKNPLPLKETIEQEKQAGES NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaaacccgatatggctgagattgagaagttcgataagtcgaaattgaagaaa atggaaatgcaagagaaaaatccactgcctttgaaagaaactattgaacaggagaagcaa gcaggcgagtcttaa

DBGET integrated database retrieval system