Bos mutus (wild yak): 102275649 Help Entry 102275649         CDS       T02919                                  Symbol PLA2G5 Name (RefSeq) phospholipase A2 group V   KO K01047   secretory phospholipase A2 [EC:3.1.1.4] Organism bom  Bos mutus (wild yak) Pathway bom00564   Glycerophospholipid metabolism bom00565   Ether lipid metabolism bom00590   Arachidonic acid metabolism bom00591   Linoleic acid metabolism bom00592   alpha-Linolenic acid metabolism bom01100   Metabolic pathways bom04014   Ras signaling pathway bom04270   Vascular smooth muscle contraction bom04972   Pancreatic secretion bom04975   Fat digestion and absorption Brite KEGG Orthology (KO) [BR:bom00001]  09100 Metabolism   09103 Lipid metabolism    00564 Glycerophospholipid metabolism     102275649 (PLA2G5)    00565 Ether lipid metabolism     102275649 (PLA2G5)    00590 Arachidonic acid metabolism     102275649 (PLA2G5)    00591 Linoleic acid metabolism     102275649 (PLA2G5)    00592 alpha-Linolenic acid metabolism     102275649 (PLA2G5)  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102275649 (PLA2G5)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     102275649 (PLA2G5)   09154 Digestive system    04972 Pancreatic secretion     102275649 (PLA2G5)    04975 Fat digestion and absorption     102275649 (PLA2G5)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bom03036]     102275649 (PLA2G5) Enzymes [BR:bom01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.1  Carboxylic-ester hydrolases     3.1.1.4  phospholipase A2      102275649 (PLA2G5) Chromosome and associated proteins [BR:bom03036]  Eukaryotic type   Centrosome formation proteins    Centriole proteins     102275649 (PLA2G5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phospholip_A2_1 Phospholip_A2_2 Motif Other DBs NCBI-GeneID:  102275649 NCBI-ProteinID:  XP_014336770 UniProt:  L8HZY3 LinkDB All DBs Position 2:3468870..3489325 Genome browser AA seq 138 aa AA seqDB search MKGLLMLAWFLACSVPAVPGSLLDLKSMIEKVTGKPALKYYGFYGCYCGWGGHGTPMDGT DWCCWKHDHCYAQMETQDCDVLTQAYRYRVAWGFIICEHGSRCQQQLCACDQKFVYCLKR NMRSYNPLYQYFPNFLCT NT seq 417 nt NT seq  +upstreamnt  +downstreamnt atgaagggcctcctcatgctggcttggttcctggcttgtagtgtgcctgctgtcccaggg agcttgctggacctgaagtcgatgattgagaaggtgactggaaagcccgccctgaagtac tatggcttctacggctgttactgtggctgggggggtcatggcacccccatggatgggact gattggtgctgttggaagcatgaccactgctacgcccagatggagacacaagactgtgac gtcttgacacaggcctacagatacagggttgcgtggggcttcatcatctgcgaacacggg tcccgctgccagcagcagctctgcgcatgcgatcagaaattcgtctactgcctgaaaaga aacatgaggagctacaaccctctttatcaatactttcccaacttcctctgcacctag

DBGET integrated database retrieval system