Bos mutus (wild yak): 102275662 Help Entry 102275662         CDS       T02919                                  Symbol POLE4 Name (RefSeq) DNA polymerase epsilon subunit 4   KO K03506   DNA polymerase epsilon subunit 4 [EC:2.7.7.7] Organism bom  Bos mutus (wild yak) Pathway bom03030   DNA replication bom03410   Base excision repair bom03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:bom00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     102275662 (POLE4)    03410 Base excision repair     102275662 (POLE4)    03420 Nucleotide excision repair     102275662 (POLE4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bom03032]     102275662 (POLE4)    03400 DNA repair and recombination proteins [BR:bom03400]     102275662 (POLE4) Enzymes [BR:bom01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      102275662 (POLE4) DNA replication proteins [BR:bom03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     102275662 (POLE4) DNA repair and recombination proteins [BR:bom03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       102275662 (POLE4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone TAF CENP-T_C Motif Other DBs NCBI-GeneID:  102275662 NCBI-ProteinID:  XP_070235960 LinkDB All DBs Position 11:96766730..96778287 Genome browser AA seq 116 aa AA seqDB search MAAAAPGSGASREEEGTGGDAATPQPPAPTSAPGARLSRLPLARVKALVKADPDVTLAGQ EAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggcggcggcggcgcctggaagcggggcttcccgggaggaggagggcaccggtggggac gcagccactccgcagcccccagccccgacgagtgcgcccggagctcgtctctcgaggctg cctctggcgcgagtcaaggccttggtgaaggcggaccccgacgtgactctcgcgggacag gaagccatcttcattctggcacgcgccgcggaactgtttgtggaaaccattgcaaaagat gcctactgttgtgctcaacaagggaagaggaaaactcttcagcggagagatttggataat gcaatagaagctgtggatgaatttgcttttctggaaggtactttggattga

DBGET integrated database retrieval system