Bos mutus (wild yak): 102277911 Help Entry 102277911         CDS       T02919                                  Symbol TNF Name (RefSeq) tumor necrosis factor isoform X1   KO K03156   tumor necrosis factor superfamily, member 2 Organism bom  Bos mutus (wild yak) Pathway bom01523   Antifolate resistance bom04010   MAPK signaling pathway bom04060   Cytokine-cytokine receptor interaction bom04061   Viral protein interaction with cytokine and cytokine receptor bom04064   NF-kappa B signaling pathway bom04071   Sphingolipid signaling pathway bom04150   mTOR signaling pathway bom04210   Apoptosis bom04217   Necroptosis bom04350   TGF-beta signaling pathway bom04380   Osteoclast differentiation bom04612   Antigen processing and presentation bom04620   Toll-like receptor signaling pathway bom04621   NOD-like receptor signaling pathway bom04622   RIG-I-like receptor signaling pathway bom04625   C-type lectin receptor signaling pathway bom04640   Hematopoietic cell lineage bom04650   Natural killer cell mediated cytotoxicity bom04657   IL-17 signaling pathway bom04660   T cell receptor signaling pathway bom04664   Fc epsilon RI signaling pathway bom04668   TNF signaling pathway bom04920   Adipocytokine signaling pathway bom04930   Type II diabetes mellitus bom04931   Insulin resistance bom04932   Non-alcoholic fatty liver disease bom04933   AGE-RAGE signaling pathway in diabetic complications bom04936   Alcoholic liver disease bom04940   Type I diabetes mellitus bom05010   Alzheimer disease bom05014   Amyotrophic lateral sclerosis bom05020   Prion disease bom05022   Pathways of neurodegeneration - multiple diseases bom05132   Salmonella infection bom05133   Pertussis bom05134   Legionellosis bom05135   Yersinia infection bom05140   Leishmaniasis bom05142   Chagas disease bom05143   African trypanosomiasis bom05144   Malaria bom05145   Toxoplasmosis bom05146   Amoebiasis bom05152   Tuberculosis bom05160   Hepatitis C bom05161   Hepatitis B bom05163   Human cytomegalovirus infection bom05164   Influenza A bom05165   Human papillomavirus infection bom05166   Human T-cell leukemia virus 1 infection bom05168   Herpes simplex virus 1 infection bom05169   Epstein-Barr virus infection bom05170   Human immunodeficiency virus 1 infection bom05171   Coronavirus disease - COVID-19 bom05205   Proteoglycans in cancer bom05310   Asthma bom05321   Inflammatory bowel disease bom05322   Systemic lupus erythematosus bom05323   Rheumatoid arthritis bom05330   Allograft rejection bom05332   Graft-versus-host disease bom05410   Hypertrophic cardiomyopathy bom05414   Dilated cardiomyopathy bom05417   Lipid and atherosclerosis bom05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102277911 (TNF)    04350 TGF-beta signaling pathway     102277911 (TNF)    04064 NF-kappa B signaling pathway     102277911 (TNF)    04668 TNF signaling pathway     102277911 (TNF)    04071 Sphingolipid signaling pathway     102277911 (TNF)    04150 mTOR signaling pathway     102277911 (TNF)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102277911 (TNF)    04061 Viral protein interaction with cytokine and cytokine receptor     102277911 (TNF)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     102277911 (TNF)    04217 Necroptosis     102277911 (TNF)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102277911 (TNF)    04620 Toll-like receptor signaling pathway     102277911 (TNF)    04621 NOD-like receptor signaling pathway     102277911 (TNF)    04622 RIG-I-like receptor signaling pathway     102277911 (TNF)    04625 C-type lectin receptor signaling pathway     102277911 (TNF)    04650 Natural killer cell mediated cytotoxicity     102277911 (TNF)    04612 Antigen processing and presentation     102277911 (TNF)    04660 T cell receptor signaling pathway     102277911 (TNF)    04657 IL-17 signaling pathway     102277911 (TNF)    04664 Fc epsilon RI signaling pathway     102277911 (TNF)   09152 Endocrine system    04920 Adipocytokine signaling pathway     102277911 (TNF)   09158 Development and regeneration    04380 Osteoclast differentiation     102277911 (TNF)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     102277911 (TNF)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102277911 (TNF)    05170 Human immunodeficiency virus 1 infection     102277911 (TNF)    05161 Hepatitis B     102277911 (TNF)    05160 Hepatitis C     102277911 (TNF)    05171 Coronavirus disease - COVID-19     102277911 (TNF)    05164 Influenza A     102277911 (TNF)    05168 Herpes simplex virus 1 infection     102277911 (TNF)    05163 Human cytomegalovirus infection     102277911 (TNF)    05169 Epstein-Barr virus infection     102277911 (TNF)    05165 Human papillomavirus infection     102277911 (TNF)   09171 Infectious disease: bacterial    05132 Salmonella infection     102277911 (TNF)    05135 Yersinia infection     102277911 (TNF)    05133 Pertussis     102277911 (TNF)    05134 Legionellosis     102277911 (TNF)    05152 Tuberculosis     102277911 (TNF)   09174 Infectious disease: parasitic    05146 Amoebiasis     102277911 (TNF)    05144 Malaria     102277911 (TNF)    05145 Toxoplasmosis     102277911 (TNF)    05140 Leishmaniasis     102277911 (TNF)    05142 Chagas disease     102277911 (TNF)    05143 African trypanosomiasis     102277911 (TNF)   09163 Immune disease    05310 Asthma     102277911 (TNF)    05322 Systemic lupus erythematosus     102277911 (TNF)    05323 Rheumatoid arthritis     102277911 (TNF)    05321 Inflammatory bowel disease     102277911 (TNF)    05330 Allograft rejection     102277911 (TNF)    05332 Graft-versus-host disease     102277911 (TNF)   09164 Neurodegenerative disease    05010 Alzheimer disease     102277911 (TNF)    05014 Amyotrophic lateral sclerosis     102277911 (TNF)    05020 Prion disease     102277911 (TNF)    05022 Pathways of neurodegeneration - multiple diseases     102277911 (TNF)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102277911 (TNF)    05418 Fluid shear stress and atherosclerosis     102277911 (TNF)    05410 Hypertrophic cardiomyopathy     102277911 (TNF)    05414 Dilated cardiomyopathy     102277911 (TNF)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     102277911 (TNF)    04940 Type I diabetes mellitus     102277911 (TNF)    04936 Alcoholic liver disease     102277911 (TNF)    04932 Non-alcoholic fatty liver disease     102277911 (TNF)    04931 Insulin resistance     102277911 (TNF)    04933 AGE-RAGE signaling pathway in diabetic complications     102277911 (TNF)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     102277911 (TNF)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bom04052]     102277911 (TNF)    00536 Glycosaminoglycan binding proteins [BR:bom00536]     102277911 (TNF) Cytokines and neuropeptides [BR:bom04052]  Cytokines   Tumor necrosis fators    102277911 (TNF) Glycosaminoglycan binding proteins [BR:bom00536]  Heparan sulfate / Heparin   Cytokines    102277911 (TNF) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  102277911 NCBI-ProteinID:  XP_005904240 UniProt:  L8I119 LinkDB All DBs Position 23:23354742..23357638 Genome browser AA seq 234 aa AA seqDB search MSTKSMIRDVELAEEVLSEKAGGPQGSRSCLCLSLFSFLLVAGATTLFCLLHFGVIGPQR EEQSPGGPSINSPLVQTLRSSSQASSNKPVAHVVADINSPGQLRWWDSYANALMANGVKL EDNQLVVPADGLYLIYSQVLFRGQGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHR ETPEWAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPDYLDYAESGQVYFGIIAL NT seq 705 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaaaagcatgatccgggatgtggagctggcggaggaggtgctctccgagaaa gcagggggcccccagggctccagaagttgcttgtgcctcagcctcttctccttcctcctg gttgcaggagccaccacgctcttctgcctgctgcacttcggggtaatcggcccccagagg gaagagcagtccccaggtggcccctccatcaacagccctctggttcaaacactcaggtcc tcttctcaagcctcaagtaacaagccggtagcccacgttgtagccgacatcaactctccg gggcagctccggtggtgggactcgtatgccaatgccctcatggccaacggtgtgaagctg gaagacaaccagctggtggtgcctgctgacgggctttacctcatctactcacaggtcctc ttcaggggccaaggctgcccttccacccccttgttcctcacccacaccatcagccgcatt gcagtctcctaccagaccaaggtcaacatcctgtctgccatcaagagcccttgccacagg gagaccccagagtgggctgaggccaagccctggtacgaacccatctaccagggaggagtc ttccagctggagaagggagatcgcctcagtgctgagatcaacctgccggactacctggac tatgccgagtctgggcaggtctactttgggatcatcgccctgtga

DBGET integrated database retrieval system