Bos mutus (wild yak): 102284581 Help Entry 102284581         CDS       T02919                                  Name (RefSeq) interferon beta-3   KO K05415   interferon beta Organism bom  Bos mutus (wild yak) Pathway bom04060   Cytokine-cytokine receptor interaction bom04151   PI3K-Akt signaling pathway bom04217   Necroptosis bom04380   Osteoclast differentiation bom04620   Toll-like receptor signaling pathway bom04621   NOD-like receptor signaling pathway bom04622   RIG-I-like receptor signaling pathway bom04623   Cytosolic DNA-sensing pathway bom04630   JAK-STAT signaling pathway bom04650   Natural killer cell mediated cytotoxicity bom04668   TNF signaling pathway bom04936   Alcoholic liver disease bom05135   Yersinia infection bom05142   Chagas disease bom05152   Tuberculosis bom05160   Hepatitis C bom05161   Hepatitis B bom05162   Measles bom05163   Human cytomegalovirus infection bom05164   Influenza A bom05165   Human papillomavirus infection bom05167   Kaposi sarcoma-associated herpesvirus infection bom05168   Herpes simplex virus 1 infection bom05169   Epstein-Barr virus infection bom05170   Human immunodeficiency virus 1 infection bom05171   Coronavirus disease - COVID-19 bom05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102284581    04668 TNF signaling pathway     102284581    04151 PI3K-Akt signaling pathway     102284581   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102284581  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102284581  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102284581    04621 NOD-like receptor signaling pathway     102284581    04622 RIG-I-like receptor signaling pathway     102284581    04623 Cytosolic DNA-sensing pathway     102284581    04650 Natural killer cell mediated cytotoxicity     102284581   09158 Development and regeneration    04380 Osteoclast differentiation     102284581  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102284581    05161 Hepatitis B     102284581    05160 Hepatitis C     102284581    05171 Coronavirus disease - COVID-19     102284581    05164 Influenza A     102284581    05162 Measles     102284581    05168 Herpes simplex virus 1 infection     102284581    05163 Human cytomegalovirus infection     102284581    05167 Kaposi sarcoma-associated herpesvirus infection     102284581    05169 Epstein-Barr virus infection     102284581    05165 Human papillomavirus infection     102284581   09171 Infectious disease: bacterial    05135 Yersinia infection     102284581    05152 Tuberculosis     102284581   09174 Infectious disease: parasitic    05142 Chagas disease     102284581   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102284581   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102284581  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bom04052]     102284581 Cytokines and neuropeptides [BR:bom04052]  Cytokines   Interferons    102284581 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon OrgA_MxiK Motif Other DBs NCBI-GeneID:  102284581 NCBI-ProteinID:  XP_005910615 UniProt:  L8HQW6 LinkDB All DBs Position 8:complement(89035179..89035790) Genome browser AA seq 185 aa AA seqDB search MTHRCLLQMVLLLCFSTTALPRSYSLLGLQERRSAAVSQKLLWQLPSTPQRCLEARMDFQ MPEEMKQAQQFQKEDAILVMYEMLQQIFGILTRDFSSTGWSETIIEDLLVELYGQMNRLQ PIQKEIMQEQNFTMGDTTVLHLKKYYFNLVQYLESKEYNRCAWTVVQSANTHELFFPDET NSFPP NT seq 558 nt NT seq  +upstreamnt  +downstreamnt atgacccaccggtgcctcctccagatggttctcctgctgtgtttctccaccacagctctt cccaggagctacagcttgcttggattgcaagaaaggcggagtgctgcggtctctcagaaa ctcctgtggcagttaccttcaactcctcaacgttgcctcgaggccaggatggacttccag atgcctgaggagatgaagcaagcacagcagttccagaaggaagatgccatattggtcatg tatgagatgctccagcagatcttcggcattctcaccagagacttctccagcactggctgg tctgagaccatcattgaggacctccttgtggaactctatgggcagatgaatcgtctgcag ccaatccagaaggaaataatgcaggagcaaaacttcaccatgggggacacaaccgttctt cacctgaagaagtattacttcaacctcgtgcagtacctggagtccaaggagtacaacagg tgtgcctggacagtcgtgcagagtgcaaatactcacgaacttttctttcctgatgagact aacagcttccctccgtga

DBGET integrated database retrieval system