Bos mutus (wild yak): 102284897 Help Entry 102284897         CDS       T02919                                  Symbol FGF2 Name (RefSeq) fibroblast growth factor 2   KO K18497   fibroblast growth factor 2 Organism bom  Bos mutus (wild yak) Pathway bom01521   EGFR tyrosine kinase inhibitor resistance bom04010   MAPK signaling pathway bom04014   Ras signaling pathway bom04015   Rap1 signaling pathway bom04020   Calcium signaling pathway bom04151   PI3K-Akt signaling pathway bom04550   Signaling pathways regulating pluripotency of stem cells bom04810   Regulation of actin cytoskeleton bom05167   Kaposi sarcoma-associated herpesvirus infection bom05200   Pathways in cancer bom05205   Proteoglycans in cancer bom05207   Chemical carcinogenesis - receptor activation bom05218   Melanoma bom05224   Breast cancer bom05226   Gastric cancer Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102284897 (FGF2)    04014 Ras signaling pathway     102284897 (FGF2)    04015 Rap1 signaling pathway     102284897 (FGF2)    04020 Calcium signaling pathway     102284897 (FGF2)    04151 PI3K-Akt signaling pathway     102284897 (FGF2)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     102284897 (FGF2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102284897 (FGF2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102284897 (FGF2)    05205 Proteoglycans in cancer     102284897 (FGF2)    05207 Chemical carcinogenesis - receptor activation     102284897 (FGF2)   09162 Cancer: specific types    05226 Gastric cancer     102284897 (FGF2)    05218 Melanoma     102284897 (FGF2)    05224 Breast cancer     102284897 (FGF2)   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     102284897 (FGF2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102284897 (FGF2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bom04052]     102284897 (FGF2)    00536 Glycosaminoglycan binding proteins [BR:bom00536]     102284897 (FGF2) Cytokines and neuropeptides [BR:bom04052]  Cytokines   Growth factors (RTK binding)    102284897 (FGF2) Glycosaminoglycan binding proteins [BR:bom00536]  Heparan sulfate / Heparin   Growth factors/receptors    102284897 (FGF2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Fascin IL1 Motif Other DBs NCBI-GeneID:  102284897 NCBI-ProteinID:  XP_005899792 UniProt:  L8IAJ6 LinkDB All DBs Position 17:37712553..37766312 Genome browser AA seq 155 aa AA seqDB search MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHI KLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKY SSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atggccgccgggagcatcaccacgctgccagccctgccggaggacggcggcagcggcgct ttcccgccgggccacttcaaggaccccaagcggctgtactgcaagaacgggggcttcttc ctgcgcatccaccccgacggccgagtggacggggtccgcgagaagagcgacccacacatc aaactacaacttcaagcagaagagagaggggttgtgtctatcaaaggagtgtgtgcaaac cgttaccttgctatgaaagaagatggaagattactagcttctaaatgtgttacagacgag tgtttcttttttgaacgattggagtctaataactacaatacttaccggtcaaggaaatac tccagttggtatgtggcactgaaacgaactgggcagtataaacttggacccaaaacagga cctgggcagaaagctatactttttcttccaatgtctgctaagagctga

DBGET integrated database retrieval system