Bos mutus (wild yak): 102288254 Help Entry 102288254         CDS       T02919                                  Symbol MAX Name (RefSeq) protein max isoform X1   KO K04453   Max protein Organism bom  Bos mutus (wild yak) Pathway bom03083   Polycomb repressive complex bom04010   MAPK signaling pathway bom05200   Pathways in cancer bom05202   Transcriptional misregulation in cancer bom05222   Small cell lung cancer Brite KEGG Orthology (KO) [BR:bom00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     102288254 (MAX)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102288254 (MAX)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102288254 (MAX)    05202 Transcriptional misregulation in cancer     102288254 (MAX)   09162 Cancer: specific types    05222 Small cell lung cancer     102288254 (MAX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:bom03000]     102288254 (MAX)    03036 Chromosome and associated proteins [BR:bom03036]     102288254 (MAX) Transcription factors [BR:bom03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     102288254 (MAX) Chromosome and associated proteins [BR:bom03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      102288254 (MAX) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HLH JetA Filament bZIP_2 bHLH_INO4 SlyX SLX9 bHLH_INO2 DUF7801 GAGA_bind DUF4763 XhlA Csm1_N Motif Other DBs NCBI-GeneID:  102288254 NCBI-ProteinID:  XP_005909828 LinkDB All DBs Position 10:31532788..31557187 Genome browser AA seq 160 aa AA seqDB search MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDS SLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatct gcggctgacaaacgggctcatcataatgcactggaacgaaaacgcagggaccacatcaaa gacagctttcacagtttgcgggactcggtcccctcactccaaggagagaaggcatcccgg gcccaaatcctagacaaagccacagagtatatccagtatatgcgaaggaaaaaccacaca caccagcaagatattgatgacctcaagcggcagaatgctctcctggagcagcaagtccgt gcactggagaaggcgaggtcgagtgcccaactgcagaccaactacccctcctcagacagc agcctctacaccaacgccaagggcagcaccatctctgccttcgatgggggctcggactcc agctcggagtcggagcctgaagagccccaaagcaggaagaagctccggatggaggccagc taa

DBGET integrated database retrieval system