Bos mutus (wild yak): 138991483 Help Entry 138991483         CDS       T02919                                  Name (RefSeq) ras-related protein Rap-1b-like   KO K07836   Ras-related protein Rap-1B Organism bom  Bos mutus (wild yak) Pathway bom04010   MAPK signaling pathway bom04014   Ras signaling pathway bom04015   Rap1 signaling pathway bom04024   cAMP signaling pathway bom04062   Chemokine signaling pathway bom04510   Focal adhesion bom04520   Adherens junction bom04611   Platelet activation bom04670   Leukocyte transendothelial migration bom04720   Long-term potentiation bom04722   Neurotrophin signaling pathway bom04934   Cushing syndrome bom04972   Pancreatic secretion bom05211   Renal cell carcinoma bom05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     138991483    04014 Ras signaling pathway     138991483    04015 Rap1 signaling pathway     138991483    04024 cAMP signaling pathway     138991483  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     138991483    04520 Adherens junction     138991483  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     138991483    04670 Leukocyte transendothelial migration     138991483    04062 Chemokine signaling pathway     138991483   09154 Digestive system    04972 Pancreatic secretion     138991483   09156 Nervous system    04720 Long-term potentiation     138991483    04722 Neurotrophin signaling pathway     138991483  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     138991483   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     138991483   09167 Endocrine and metabolic disease    04934 Cushing syndrome     138991483  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bom04147]     138991483    04031 GTP-binding proteins [BR:bom04031]     138991483 Exosome [BR:bom04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    138991483   Exosomal proteins of other body fluids (saliva and urine)    138991483   Exosomal proteins of colorectal cancer cells    138991483 GTP-binding proteins [BR:bom04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     138991483 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha RsgA_GTPase Motif Other DBs NCBI-GeneID:  138991483 NCBI-ProteinID:  XP_070242260 LinkDB All DBs Position 17:17179250..17180291 Genome browser AA seq 196 aa AA seqDB search MHEYKLVVLGSGGVGKSALTIQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTHDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS CQLLYYTKCIVALSQV NT seq 591 nt NT seq  +upstreamnt  +downstreamnt atgcatgagtataagctagtcgttcttggctcgggaggcgttggaaaatctgctctgact atacagtttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttat agaaagcaagttgaagtagatgcacagcagtgtatgcttgaaatcttggatactgcagga acggaacaattcacagcaatgagggatttgtacatgaaaaatggacaaggctttgcgtta gtttattccatcacagcacagtccacatttaatgatttacaagatctgagagaacagatt cttcgagttaaagacacgcatgatgttccaatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcaagacagtggaataac tgtgcattcttagaatcctctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcgacaaattaacagaaaaacgccagtgcctgggaaggcccgcaaaaagtcgtca tgtcagctgctttactatactaaatgcattgtagctctgagccaggtctga

DBGET integrated database retrieval system