Bipolaris oryzae: COCMIDRAFT_103083 Help Entry COCMIDRAFT_103083 CDS       T03125                                  Name (RefSeq) hypothetical protein   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism bor  Bipolaris oryzae Pathway bor03420   Nucleotide excision repair bor04111   Cell cycle - yeast bor04120   Ubiquitin mediated proteolysis bor04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:bor00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     COCMIDRAFT_103083    04120 Ubiquitin mediated proteolysis     COCMIDRAFT_103083   09124 Replication and repair    03420 Nucleotide excision repair     COCMIDRAFT_103083  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     COCMIDRAFT_103083  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:bor04121]     COCMIDRAFT_103083    03400 DNA repair and recombination proteins [BR:bor03400]     COCMIDRAFT_103083 Enzymes [BR:bor01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      COCMIDRAFT_103083 Ubiquitin system [BR:bor04121]  Ubiquitin ligases (E3)   UBL E3 ligases    COCMIDRAFT_103083   Multi subunit type E3    SCF complex     Ring finger protein      COCMIDRAFT_103083    Cul2 complex      COCMIDRAFT_103083    Cul3 complex      COCMIDRAFT_103083    Cul4 complex      COCMIDRAFT_103083    Cul7 complex      COCMIDRAFT_103083    Cul8 complex      COCMIDRAFT_103083    Cul9 complex      COCMIDRAFT_103083 DNA repair and recombination proteins [BR:bor03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       COCMIDRAFT_103083     TCR (transcription coupled repair) factors      Cul4-CSA complex       COCMIDRAFT_103083 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 PHD_NSD zf-RING_16 Motif Other DBs NCBI-GeneID:  19118217 NCBI-ProteinID:  XP_007690879 JGI:  Cocmi1_103083 UniProt:  W6YYE9 LinkDB All DBs Position Unknown AA seq 111 aa AA seqDB search MADAPPAKTKTSKAGASGEGDKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQ ANQASATSEECTVAWGICNHAFHFHCISRWLKTRQVCPLDNRDWEFQKYGR NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggcagatgcgcccccggccaagaccaagacatccaaggccggcgccagtggagagggc gacaagaagcgcttcgaggtcaagaagtggaatgccgttgctctctgggcctgggacatc gtcgtcgacaactgtgccatttgccgcaaccacatcatggacctgtgcattgaatgccag gccaaccaagcttcggcaactagcgaagagtgcacggtagcctggggtatctgcaaccac gccttccacttccactgcatctcacgatggctcaagacgcgacaggtctgcccgctagac aacagggactgggagttccaaaagtacggccgatag

DBGET integrated database retrieval system