KEGG   Orrella marina: DBV39_10430
Entry
DBV39_10430       CDS       T05532                                 
Symbol
ligA
Name
(GenBank) DNA ligase
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
boz  Orrella marina
Pathway
boz03030  DNA replication
boz03410  Base excision repair
boz03420  Nucleotide excision repair
boz03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:boz00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    DBV39_10430 (ligA)
   03410 Base excision repair
    DBV39_10430 (ligA)
   03420 Nucleotide excision repair
    DBV39_10430 (ligA)
   03430 Mismatch repair
    DBV39_10430 (ligA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:boz03032]
    DBV39_10430 (ligA)
   03400 DNA repair and recombination proteins [BR:boz03400]
    DBV39_10430 (ligA)
Enzymes [BR:boz01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     DBV39_10430 (ligA)
DNA replication proteins [BR:boz03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     DBV39_10430 (ligA)
DNA repair and recombination proteins [BR:boz03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     DBV39_10430 (ligA)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     DBV39_10430 (ligA)
   MMR (mismatch excision repair)
    DNA ligase
     DBV39_10430 (ligA)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      DBV39_10430 (ligA)
SSDB
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB HHH_2 HHH_5 BRCT DNA_ligase_ZBD Nlig-Ia PTCB-BRCT HHH BRCT_2
Other DBs
NCBI-ProteinID: AWB34063
UniProt: A0A2R4XJX3
LinkDB
Position
complement(2287835..2289895)
AA seq 686 aa
MTAPDILERVRTLRDQIEQHNRAYYLQDSPTVSDAEYDNLMRELESLEVQHPELVTPDSP
TQRVGVKPSERFATVVHQVPMLSLGNAFEQQEVIAFDKRVSDTLRQAGLIHPGQDVEYFC
ELKLDGLAISLRYENGLLVQAATRGDGQTGEDVTANVKTIKSIPLRLKSEPNGPNSVGVP
EILEVRGEVFMNLADFRRLNERQAERSEKVFVNPRNAAAGSLRQLDPAVTARRPLRFFAY
GWGEVSEALPERHEDILNWFVQLGLPVNVSEHQCVRSAKGLMAFYEQVGGKRERLLYDID
GVVYKVNALAAQRTLGYVARAPRFALAHKFPAQEVTTRLLDIQFQVGRTGAITPVARLEP
VFVGGVTVTSATLHNEDEIRRKDVRVGDMVVVRRAGDVIPEVLGPVLEKRSEGATPFEMI
NACPVCGSAIERPEGEAVARCTGGLVCQAQRKQSLIHAVSRKALDIDGLGDKLVEQLVDT
GRVRTLADVFTLKVEELEALDRMGSKSAQNLVNAINAAAQPTLARFIYALGIRHVGETTA
RDLAQSFGCIQALMDADEDALLAVSDVGPVVAKSIQHFFAEPHNREVVADLLAHGVVPQQ
AAQSTAQSDQLAGKTFVLTGTLPGWTREEATQAILEAGGKVTGSVSKKTSYVVAGSEAGS
KLEKARQLGVIILDEDQLKSLLARSG
NT seq 2061 nt   +upstreamnt  +downstreamnt
atgacagcacctgatattcttgagcgcgtgcgtacgctgcgcgatcagattgaacagcat
aaccgtgcgtattatttacaggactcaccgaccgtttcagatgccgagtacgacaatctg
atgcgtgaactggaatcgctggaagtgcagcatcctgagctggtgacaccagattcgccc
acccagcgtgtcggtgtcaaaccctctgagcggtttgcgaccgtcgtccatcaggtaccg
atgctttccctgggtaatgcgtttgaacagcaggaagtgattgcgttcgacaaacgggtg
tcagatacattgcgtcaagcgggtctgattcatccagggcaggatgtagagtatttttgt
gaactcaaactcgatggccttgcgatcagtttgcggtacgagaacggattgctggtgcaa
gccgcaaccagaggggatggccagactggcgaggacgtcactgcaaacgtcaagacgatc
aagtccatcccattacgcctaaagtctgaaccgaatggtccgaactcagtgggtgtgccc
gagatactggaggtgcgtggcgaagtcttcatgaatctggcggactttcggcgtctgaat
gagcggcaggcggaacgctcggagaaggtgtttgtcaaccctcgcaacgctgctgcgggt
agtctgcgtcaacttgatcccgcagtgaccgcacgcaggccattgaggttttttgcgtat
ggctggggcgaggtcagtgaagcgctcccagaaagacacgaagatattctcaactggttt
gttcagctcgggctaccggtgaatgtgtcagaacaccagtgtgtacgttcagccaaaggg
ctgatggccttttacgagcaagtagggggtaagcgggagcgattgctctacgacatcgac
ggtgtggtttacaaggttaatgctctcgcggcacaacgaaccctggggtacgttgcccgt
gcacctcggtttgcgttggcgcacaagtttccggctcaggaagtgacgacccgactgctt
gatattcagtttcaggttggacgtactggcgcgattacaccagttgcacgactcgaacca
gtgttcgtcggtggcgtcaccgtgaccagtgctaccctgcacaatgaggacgagattcgc
agaaaggatgtgcgtgttggcgatatggtggtcgttcgacgtgcgggcgatgtcattccg
gaggtgctcggacccgttctggagaagcgttccgaaggcgcgactcccttcgagatgatc
aatgcgtgtcccgtatgtggatctgcgattgagagacctgagggtgaggctgtcgcgcgt
tgtaccggcgggctggtctgccaggcccagcgcaagcaaagcctgatacacgcagttagt
cgcaaggcgcttgatattgatggtcttggagacaagctggtcgagcagctggtggatacc
gggcgtgtccggacgctggcagatgtctttacattgaaggtggaggaacttgaagccctt
gacagaatgggcagcaaatcagctcagaatctggtcaacgcaatcaatgcggcagcacaa
ccaacattggccaggtttatttatgcattgggcatacgccatgtcggagagaccactgcc
cgggatctggcccaaagttttgggtgcatacaggcactcatggatgctgatgaagatgcg
ttgctggccgtttctgatgttggtcctgtcgtggcaaagtcgatccagcatttttttgcg
gagccgcataatcgggaggttgtcgcggatctgcttgcgcacggagttgttccgcaacaa
gctgcacaatcaactgcacagtcggatcagcttgctggcaagacgtttgtgctgactgga
acgctacctggctggacaagggaagaagccacacaggcaattctcgaggcgggtggaaag
gtcacgggctcagtctcgaagaaaacgagctatgtcgtggctggttcggaagcaggctcg
aagcttgaaaaggccaggcaactgggtgtcatcattcttgatgaagatcagctcaagtcc
ttgctcgccaggtctggctga

DBGET integrated database retrieval system