Bordetella parapertussis Bpp5: BN117_3985 Help Entry BN117_3985        CDS       T02297                                  Name (GenBank) acyl carrier protein   KO K14188   D-alanine--poly(phosphoribitol) ligase subunit 2 [EC:6.1.1.13] Organism bpar  Bordetella parapertussis Bpp5 Pathway bpar00470   D-Amino acid metabolism bpar00552   Teichoic acid biosynthesis bpar01100   Metabolic pathways bpar01503   Cationic antimicrobial peptide (CAMP) resistance bpar02020   Two-component system Brite KEGG Orthology (KO) [BR:bpar00001]  09100 Metabolism   09106 Metabolism of other amino acids    00470 D-Amino acid metabolism     BN117_3985   09107 Glycan biosynthesis and metabolism    00552 Teichoic acid biosynthesis     BN117_3985  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     BN117_3985  09160 Human Diseases   09175 Drug resistance: antimicrobial    01503 Cationic antimicrobial peptide (CAMP) resistance     BN117_3985  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    01504 Antimicrobial resistance genes [BR:bpar01504]     BN117_3985 Enzymes [BR:bpar01000]  6. Ligases   6.1  Forming carbon-oxygen bonds    6.1.1  Ligases forming aminoacyl-tRNA and related compounds     6.1.1.13  D-alanine---poly(phosphoribitol) ligase      BN117_3985 Antimicrobial resistance genes [BR:bpar01504]  Gene sets   CAMP resistance modules    Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]     BN117_3985 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding GD_AH_second Motif Other DBs NCBI-ProteinID:  CCJ51318 UniProt:  K0MAQ9 LinkDB All DBs Position complement(4285971..4286210) Genome browser AA seq 79 aa AA seqDB search MHTEQELHTRIADIVESIILKKVTPDTALISSGLVDSLAAVDITLAVESEYGCSIPAPEI AEHLQSVRTLAGYVAANSQ NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgcacaccgagcaagaactgcacacccggatcgccgacatcgtcgagtcgatcatcctc aagaaagtcacccccgacactgccctgatctcttccggcctggtcgattcgctggccgcg gtcgacatcacgctggccgtcgagtcggagtacggatgcagtatcccggcgcctgaaatc gccgaacacctacagtcggtccgcacgcttgccggctatgtcgctgccaattcgcaatag

DBGET integrated database retrieval system