Bombus pascuorum (common carder bee): 132916438 Help Entry 132916438         CDS       T09597                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism bpas  Bombus pascuorum (common carder bee) Pathway bpas00510   N-Glycan biosynthesis bpas00513   Various types of N-glycan biosynthesis bpas04141   Protein processing in endoplasmic reticulum Module bpas_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:bpas00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     132916438    00513 Various types of N-glycan biosynthesis     132916438  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     132916438 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 CAAD TctB Pox_E2-like Motif Other DBs NCBI-GeneID:  132916438 NCBI-ProteinID:  XP_060832434 LinkDB All DBs Position 2:complement(10358827..10360058) Genome browser AA seq 80 aa AA seqDB search MVEIESMTRYVSPINPAIFPLLAVVLLGIGIFFTAWFFVYEVTSTKFTRDMFKELLISLV AAIFSGFGILFLLLWVGIYV NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggtggaaatcgagtctatgacaagatatgtctctcccataaatcctgcaatttttcca ttactggcagtggtgttactaggaattggaatattctttacagcatggttctttgtttat gaagttactagcacaaaatttacaagggacatgtttaaagaattattaatctctctagta gcagcaatattttctggttttggtatattatttttactcctttgggttggaatttatgta tag

DBGET integrated database retrieval system