KEGG   Bordetella petrii: Bpet3742
Entry
Bpet3742          CDS       T00637                                 
Symbol
hcaB
Name
(GenBank) 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase
  KO
K16269  cis-1,2-dihydrobenzene-1,2-diol/chlorobenzene dihydrodiol dehydrogenase [EC:1.3.1.19 1.3.1.119]
Organism
bpt  Bordetella petrii
Pathway
bpt00361  Chlorocyclohexane and chlorobenzene degradation
bpt00362  Benzoate degradation
bpt00623  Toluene degradation
bpt00624  Polycyclic aromatic hydrocarbon degradation
bpt00643  Styrene degradation
bpt01100  Metabolic pathways
bpt01120  Microbial metabolism in diverse environments
bpt01220  Degradation of aromatic compounds
Module
bpt_M00547  Benzene/toluene degradation, benzene => catechol / toluene => 3-methylcatechol
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bpet3742 (hcaB)
   00361 Chlorocyclohexane and chlorobenzene degradation
    Bpet3742 (hcaB)
   00623 Toluene degradation
    Bpet3742 (hcaB)
   00643 Styrene degradation
    Bpet3742 (hcaB)
   00624 Polycyclic aromatic hydrocarbon degradation
    Bpet3742 (hcaB)
Enzymes [BR:bpt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.19  cis-1,2-dihydrobenzene-1,2-diol dehydrogenase
     Bpet3742 (hcaB)
    1.3.1.119  chlorobenzene dihydrodiol dehydrogenase
     Bpet3742 (hcaB)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR 3Beta_HSD Epimerase
Other DBs
NCBI-ProteinID: CAP44085
UniProt: A9I2Q4
LinkDB
Position
3951139..3951966
AA seq 275 aa
MKLKGEVALVTGGGAGLGRAIVDRYVAEGARVAVLDKSAAGLEEIRKRHGDAVVGIEGDV
RSLDSHREAVARCVETFGKLDCLIGNAGVWDYLTQLADIPDNGISEAFDEMFAINVKGYI
LAAKAALPALYKSKGSAIFTVSNAGFYPGGGGVLYTAGKHAVIGLVKQLAHEWGPRIRVN
GIAPGGILGSDLRGLKTLGLQDQTIATMPLADMLGPVLPTGRVATAEEYAGAYVFFATRA
DTVPLTGSVLNFDGGMGVRGLFEASLGAQLDKHFA
NT seq 828 nt   +upstreamnt  +downstreamnt
atgaaactcaaaggtgaagtggcattggtgacgggcggaggcgccggactggggcgagcg
atcgtcgatcgctatgtcgcagagggcgcccgcgtcgcggtgctggacaagtcggcagca
ggcctggaggaaatcaggaagcgccacggcgatgccgtggtcggcatcgagggcgatgtt
cggtcgctcgacagccatcgtgaagccgtggcgcgctgcgtcgagaccttcggaaagctc
gattgcctgatcggcaacgccggcgtttgggactacctgacccaactggcggacattccc
gacaacggcatctcggaagccttcgacgaaatgttcgcgatcaacgtcaaaggctacatc
ctggccgccaaggccgcgttgcccgcgctgtacaagagcaaaggcagcgcgatcttcacc
gtgtcgaacgctggcttctaccctggtggcggaggcgttctctacaccgcgggcaagcat
gccgtgatcggcttggtcaagcagctcgcgcatgaatgggggcctcgcatccgtgtcaac
ggcatcgcccctggagggatcctcggcagcgacctgcgcgggctcaagacgctgggtctg
caagaccaaaccattgcgacgatgccactggccgacatgctgggtcctgtccttccgacc
gggcgggtggccaccgccgaggaatacgccggagcctacgtgttcttcgccacgcgcgcg
gataccgtcccgctcaccggcagcgtgctgaacttcgacggcggcatgggcgtgcgcggc
ttgttcgaagccagtctcggtgcacagctcgacaagcatttcgcttga

DBGET integrated database retrieval system