Bombus pyrosoma: 122569175 Help Entry 122569175         CDS       T07776                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism bpyo  Bombus pyrosoma Pathway bpyo00510   N-Glycan biosynthesis bpyo00513   Various types of N-glycan biosynthesis bpyo04141   Protein processing in endoplasmic reticulum Module bpyo_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:bpyo00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     122569175    00513 Various types of N-glycan biosynthesis     122569175  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     122569175 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 CAAD TctB Pox_E2-like Motif Other DBs NCBI-GeneID:  122569175 NCBI-ProteinID:  XP_043585717 LinkDB All DBs Position LG7:9785927..9786930 Genome browser AA seq 80 aa AA seqDB search MVEIESMTRYVSPINPAIFPLLAVVLLGIGIFFTAWFFVYEVTSTKFTRDMFKELLISLV AAIFSGFGILFLLLWVGIYV NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggtggaaatcgagtctatgacaagatatgtctctcccataaatcctgcaatttttcca ttactggcagtggtgttactaggaattggaatattctttacagcatggttctttgtttat gaagttactagcacaaaatttacaagggacatgtttaaagaattattaatctctctagta gcagcaatattttctggctttggtatattatttttactcctttgggttggaatttatgta tag

DBGET integrated database retrieval system