Bradyrhizobium sp. SK17: CWS35_18550 Help Entry CWS35_18550       CDS       T05325                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism brk  Bradyrhizobium sp. SK17 Pathway brk00790   Folate biosynthesis brk01100   Metabolic pathways brk01240   Biosynthesis of cofactors Module brk_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:brk00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     CWS35_18550 (folB) Enzymes [BR:brk01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      CWS35_18550 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      CWS35_18550 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      CWS35_18550 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Uricase TTHA0829-like_ACT Motif Other DBs NCBI-ProteinID:  AUC96025 LinkDB All DBs Position complement(4046268..4046648) Genome browser AA seq 126 aa AA seqDB search MTDTIFITGIVIHARHGVMEHETEVGQRFVIDLELYTDLSESSRTDRLSDTVSYSNVVAT ATSAFKNTNYKLLERAAGAVAEDILASFPRVRAVKVTVHKPHAPIAAIFDDVGVVLTRSR HPTSQG NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgaccgacacgatcttcatcaccgggatcgtcatccatgcccgccatggcgtgatggaa catgagaccgaggtcgggcagcgcttcgtcatcgacctcgagctctacaccgacctctcg gagtcttcgcgcaccgatcgcctctccgacaccgtctcctattccaacgtggtggcgacc gcgacgtcggccttcaagaacaccaattacaagctgctggagcgcgccgccggcgcggtg gccgaggacatcctggcgagtttcccgcgcgtcagggcggtcaaggtcaccgtgcacaag ccgcacgcgccgatcgctgcgatcttcgacgatgttggcgtggtgctgacgcgctcgcgc catccgacgtcgcagggctga

DBGET integrated database retrieval system