Bacillus rossius redtenbacheri: 134541236 Help Entry 134541236         CDS       T09888                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism bror  Bacillus rossius redtenbacheri Pathway bror00510   N-Glycan biosynthesis bror00513   Various types of N-glycan biosynthesis bror04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:bror00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     134541236    00513 Various types of N-glycan biosynthesis     134541236  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     134541236 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 TctB Motif Other DBs NCBI-GeneID:  134541236 NCBI-ProteinID:  XP_063240578 LinkDB All DBs Position 18:complement(3647637..3656717) Genome browser AA seq 80 aa AA seqDB search MLEPESMARYVSPVNPSVFPHLTVVLLGIGVFFTAWFFVYEVTSTKFTRDVFKELVVALV AAIFSGFGVVFLLLWVGIYI NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgctggagccggagtcgatggcgcgctacgtgtcgccggtcaacccgtccgtgttcccg cacctcaccgtcgtgctgctgggcatcggcgtcttcttcaccgcctggttcttcgtctac gaggtcaccagcaccaagttcacccgcgacgtcttcaaggagctggtggtggcgctggtc gccgccatcttctcgggcttcggggtggtgttcctgctgctctgggtcggcatctacata tga

DBGET integrated database retrieval system