Brassica rapa (field mustard): 103845664 Help Entry 103845664         CDS       T03449                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism brp  Brassica rapa (field mustard) Pathway brp03420   Nucleotide excision repair brp04120   Ubiquitin mediated proteolysis brp04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:brp00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103845664    04120 Ubiquitin mediated proteolysis     103845664   09124 Replication and repair    03420 Nucleotide excision repair     103845664  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:brp04121]     103845664    03400 DNA repair and recombination proteins [BR:brp03400]     103845664 Enzymes [BR:brp01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      103845664 Ubiquitin system [BR:brp04121]  Ubiquitin ligases (E3)   UBL E3 ligases    103845664   Multi subunit type E3    SCF complex     Ring finger protein      103845664    Cul2 complex      103845664    Cul3 complex      103845664    Cul4 complex      103845664    Cul7 complex      103845664    Cul8 complex      103845664    Cul9 complex      103845664 DNA repair and recombination proteins [BR:brp03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       103845664     TCR (transcription coupled repair) factors      Cul4-CSA complex       103845664 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  103845664 NCBI-ProteinID:  XP_009120796 UniProt:  M4CDN1 LinkDB All DBs Position A10:14634106..14635393 Genome browser AA seq 118 aa AA seqDB search MATLDSDVNMIPAGESSSSVGASSSSKKAKRFEVKKWSAVALWAWDIVVDNCAICRNHIM DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggctaccctcgatagcgacgtaaacatgatccctgctggagaatcctcgagctccgtt ggggcttcttcgtcgagcaagaaggcgaagagattcgaagtgaagaagtggagcgccgtt gctctttgggcttgggatatcgttgttgacaattgcgccatctgcagaaaccacatcatg gatctctgcattgagtgtcaggctaatcaggccagcgctactagtgaggaatgcactgtt gcttggggggtttgtaatcatgctttccactttcactgtatcagcagatggttgaagact cgtcaagtttgtccattggataacagtgagtgggagttccagaagtatggtcactaa

DBGET integrated database retrieval system