Brassica rapa (field mustard): 103851357 Help Entry 103851357         CDS       T03449                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism brp  Brassica rapa (field mustard) Pathway brp03420   Nucleotide excision repair brp04120   Ubiquitin mediated proteolysis brp04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:brp00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103851357    04120 Ubiquitin mediated proteolysis     103851357   09124 Replication and repair    03420 Nucleotide excision repair     103851357  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:brp04121]     103851357    03400 DNA repair and recombination proteins [BR:brp03400]     103851357 Enzymes [BR:brp01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      103851357 Ubiquitin system [BR:brp04121]  Ubiquitin ligases (E3)   UBL E3 ligases    103851357   Multi subunit type E3    SCF complex     Ring finger protein      103851357    Cul2 complex      103851357    Cul3 complex      103851357    Cul4 complex      103851357    Cul7 complex      103851357    Cul8 complex      103851357    Cul9 complex      103851357 DNA repair and recombination proteins [BR:brp03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       103851357     TCR (transcription coupled repair) factors      Cul4-CSA complex       103851357 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  103851357 NCBI-ProteinID:  XP_009126455 UniProt:  A0A398AEU6 LinkDB All DBs Position A02:complement(4218513..4219733) Genome browser AA seq 119 aa AA seqDB search MASLDSDVTMVPAGESSSSVAPSSSSTKKAKRFEVKKWSAVALWAWDIVVDNCAICRNHI MDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggcttccctcgattccgacgtcaccatggttcccgcaggagaatcctcaagcagcgtc gccccatcgtcgtcgtccaccaagaaggcgaagagattcgaagttaagaagtggagcgcc gtggctctctgggcttgggatatcgttgttgataattgcgccatctgcagaaaccacatc atggatttgtgtattgaatgtcaggctaatcaggccagtgctacgagtgaggaatgcact gttgcttggggggtttgcaaccacgccttccactttcactgcatcagcagatggcttaag actcgtcaagtttgtccattggataacagtgagtgggagttccagaagtatggtcactaa

DBGET integrated database retrieval system