Brassica rapa (field mustard): 103856451 Help Entry 103856451         CDS       T03449                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism brp  Brassica rapa (field mustard) Pathway brp03420   Nucleotide excision repair brp04120   Ubiquitin mediated proteolysis brp04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:brp00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103856451    04120 Ubiquitin mediated proteolysis     103856451   09124 Replication and repair    03420 Nucleotide excision repair     103856451  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:brp04121]     103856451    03400 DNA repair and recombination proteins [BR:brp03400]     103856451 Enzymes [BR:brp01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      103856451 Ubiquitin system [BR:brp04121]  Ubiquitin ligases (E3)   UBL E3 ligases    103856451   Multi subunit type E3    SCF complex     Ring finger protein      103856451    Cul2 complex      103856451    Cul3 complex      103856451    Cul4 complex      103856451    Cul7 complex      103856451    Cul8 complex      103856451    Cul9 complex      103856451 DNA repair and recombination proteins [BR:brp03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       103856451     TCR (transcription coupled repair) factors      Cul4-CSA complex       103856451 SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  103856451 NCBI-ProteinID:  XP_009131801 UniProt:  A0A397ZWH1 A0A8D9GFK4 LinkDB All DBs Position A3 Genome browser AA seq 118 aa AA seqDB search MASLDSDVNMIPAGESSSSVAASSSSKKAKRFEVKKWSAVALWAWDIVVDNCAICRNHIM DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggcttccctcgattccgacgtaaacatgatccctgccggtgaatcctccagctccgtt gccgcttcttcgtcgagcaagaaggccaagagattcgaagttaagaagtggagcgccgtg gctctctgggcttgggatatcgttgttgacaattgcgccatctgcagaaaccacatcatg gatctctgtattgaatgtcaggctaatcaggccagcgctacgagtgaggaatgcactgtt gcttggggggtttgcaatcacgccttccactttcactgcatcagcagatggttaaagact cgtcaagtttgtccattggataacagtgagtgggagttccagaaatatggtcactaa

DBGET integrated database retrieval system