KEGG   Bacillus rugosus: M0696_03705
Entry
M0696_03705       CDS       T08218                                 
Symbol
ligA
Name
(GenBank) NAD-dependent DNA ligase LigA
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
bry  Bacillus rugosus
Pathway
bry03030  DNA replication
bry03410  Base excision repair
bry03420  Nucleotide excision repair
bry03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bry00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    M0696_03705 (ligA)
   03410 Base excision repair
    M0696_03705 (ligA)
   03420 Nucleotide excision repair
    M0696_03705 (ligA)
   03430 Mismatch repair
    M0696_03705 (ligA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bry03032]
    M0696_03705 (ligA)
   03400 DNA repair and recombination proteins [BR:bry03400]
    M0696_03705 (ligA)
Enzymes [BR:bry01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     M0696_03705 (ligA)
DNA replication proteins [BR:bry03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     M0696_03705 (ligA)
DNA repair and recombination proteins [BR:bry03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     M0696_03705 (ligA)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     M0696_03705 (ligA)
   MMR (mismatch excision repair)
    DNA ligase
     M0696_03705 (ligA)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      M0696_03705 (ligA)
SSDB
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB HHH_2 BRCT HHH_5 DNA_ligase_ZBD Nlig-Ia HHH PTCB-BRCT BRCT_2 Zn_ribbon_NUD HHH_8 5_3_exonuc HNOB zf-IS66 HHH_3 zf-tcix
Other DBs
NCBI-ProteinID: UPV79850
LinkDB
Position
712719..714725
AA seq 668 aa
MDKETAKQRADELRRTINKYSYEYYTLDEPSVPDAEYDRLMQELIAIEEEHPDLRTPDSP
TQRVGGAVLEAFQKVTHGTPMLSLGNAFNADDLRDFDRRVRQAVGDDVAYNVELKIDGLA
VSLRYEDGYFVRGATRGDGTTGEDITENLKTIRNIPLKMKRDLSIEVRGEAYMPKRSFEA
LNEERIKNEEEPFANPRNAAAGSLRQLDPKIAAKRNLDIFVYSIAELDEMGVETQSQGLD
FLDEIGFKTNQERKKCDSIEEVIALIDEFQAKRADLPYEIDGIVIKLDSLDQQEELGFTA
KSPRWAIAYKFPAEEVVTKLLDIELNVGRTGVITPTAILEPVKVAGTTVSRASLHNEDLI
KEKDIRILDKVVIKKAGDIIPEVVNVLVEQRTGEEKEFSMPTECPECGSELVRIEGEVAL
RCINPECPAQIREGLIHFVSRNAMNIDGLGERVITQLFEENLVRNVADLYKLTKEQVIQL
ERMGEKSTENLISSIQKSKENSLERLLFGLGIRFIGSKAAKTLAMHFESLENLKKASEEE
LLAIDEIGEKMADAVITYFHKEEMLDLLNELQELGVNTLYKGPKKVKAEDSDSYFAGKTI
VLTGKLEELSRNDAKAQIEALGGKLTGSVSKNTDLVIAGEAAGSKLTKAQELNIEVWNEE
QLMGELKK
NT seq 2007 nt   +upstreamnt  +downstreamnt
atggacaaagaaacagcgaagcagcgggcagacgaactgcgccgcaccatcaacaagtat
agctatgaatattacaccttagatgaaccgagcgtccctgatgctgaatacgacagattg
atgcaggagctgattgcgatcgaggaggagcatccagacctcagaacacctgactctcct
acgcagcgtgtcggcggagccgtgcttgaagcgtttcagaaagtcacacacggcacgccg
atgctcagtctgggcaacgcctttaatgccgatgatcttcgtgatttcgaccgccgggtg
cgccaggccgtcggcgacgatgtggcgtataatgtggagctgaaaatagacggtcttgct
gtttctctccgttatgaagacggctattttgtcagaggagccacaagaggtgacggaacg
acgggagaggatattacggagaatctgaagacgatccgcaatattccgctcaaaatgaaa
cgtgatctgtcgatcgaagtgcgcggcgaggcgtatatgccgaagcgttcgtttgaagcg
ctcaatgaggaacggatcaaaaacgaagaagaaccgttcgccaatccgcgaaatgccgcc
gcgggatcactcagacagctcgatccgaaaattgcagcgaaacgaaacctcgatatcttc
gtctacagtatagcggagcttgacgagatgggtgtggagacgcaaagccaggggcttgat
tttctcgacgaaatcggatttaaaacaaaccaggaacgaaaaaaatgcgacagcatagaa
gaagttattgcactgatcgatgagtttcaggctaaacgcgctgacctcccgtatgaaatt
gacggtatcgtgattaaacttgattcccttgatcagcaggaggagcttggttttacggcg
aaaagcccgcgttgggccatcgcgtataaatttcctgcagaagaggtcgtgacaaagctt
ctcgatatcgaattaaatgtcggcagaacgggtgtgattacgccgaccgcgattcttgag
ccggtaaaagttgccggcacaacggtctcaagagcatcccttcataacgaagatttaatt
aaagagaaggacattcggatcttggataaggtcgtcatcaaaaaagcgggcgatatcatt
cctgaagtcgtgaacgtcctcgttgaacagcgcacaggagaagaaaaggaattcagcatg
cccacggaatgccctgaatgcgggagcgaactcgtccgcatcgaaggagaagtggcgctt
cgctgcattaaccctgaatgtccggcgcaaatccgggaagggctgatccatttcgtttcc
cgcaatgccatgaacattgacggacttggcgaacgagtcatcacacagctgtttgaggag
aaccttgtccgcaatgtggcggatttatataagctgacgaaggaacaggtcatccagctc
gagcgtatgggagaaaaatctactgaaaacctgatcagctccatccaaaaatcaaaagaa
aattcgttagagcgcctgctgttcggactcggcatccgctttatcggttcaaaggccgca
aagacgcttgccatgcattttgaaagcttggagaacctgaaaaaagcttcagaagaggag
cttctcgcgattgatgaaatcggtgaaaaaatggctgacgcggtcatcacttattttcat
aaagaagaaatgcttgatctcttgaatgaacttcaggagttgggtgtaaatacactatac
aaaggcccgaaaaaagtaaaagcagaggacagcgattcttactttgccggtaaaacaatt
gttctgacaggaaagctggaagaactgtcaagaaacgatgccaaagcgcaaatcgaagcg
ctcggcggaaagctgactggaagcgtcagcaaaaacacagacttggtcatcgccggcgaa
gcggcgggaagcaaactgacaaaagcacaagagctgaacattgaagtgtggaatgaagaa
cagttaatgggagagctaaagaaataa

DBGET integrated database retrieval system