KEGG   Burkholderia savannae: WS86_20930
Entry
WS86_20930        CDS       T07932                                 
Name
(GenBank) siderophore biosynthesis protein
  KO
K20423  2-hydroxy-7-methoxy-5-methyl-1-naphthoate---CoA ligase [EC:6.2.1.43]
Organism
bsav  Burkholderia savannae
Pathway
bsav01100  Metabolic pathways
bsav01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsav00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01059 Biosynthesis of enediyne antibiotics
    WS86_20930
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bsav01008]
    WS86_20930
Enzymes [BR:bsav01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.43  2-hydroxy-7-methoxy-5-methyl-1-naphthoate---CoA ligase
     WS86_20930
Polyketide biosynthesis proteins [BR:bsav01008]
 Polyketide tailoring proteins
  Others
   WS86_20930
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: AOJ83169
LinkDB
Position
2:complement(605652..607274)
AA seq 540 aa
MNARLASLNRRLASALQTGGETPALIADGRVISHRELTSHVAITAERLNAHGIGKGDRVA
LQLPNSADAAVLMLATLMAGAIPVPILPAYRERELRHILKTTRPRAIALTRGSRRFSPLQ
TVVGLLSEEGLEVDLLLADGPSRADDRPEWLDLRQFCLAPADSMPRELRPVDMRADDTAM
MLLSSGTTGLPKAIARRNAGYGYMIAEGCKVFELSRSAVYLAALPLSHGFVINCPGILGT
LACGGTVVLAADASAQTSLKLIGAHGVTHTTLVPALLTQWMERADESRAGSGTLRYVQVG
GSRLPADLAAQAESRLGVRIQQCYGMSEGLLCFTRFTDPDAIRFNSQGRPLSDADEILIV
NDRDEPLPYGQSGELLTRGPYTIEQYFNDPDASRRAFTPNGYYRTGDVAHLDAAGNVYID
GRVTDTINRGGEKFCPEELEALMKRHAKLKDAACVGMPDGRFGEVSCLFAVARDGEQVSL
AELRRHLEAAGVAAFKLPEQLVLIDEIPRKGIGKIDRAALRASARANAPAVAAACRTGQV
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgaacgcgcgcctcgcttccctgaaccgacgattggccagcgccttgcagaccggaggc
gaaacacccgccctgatcgcggacggccgagtgatctcgcatcgggaattgacgtcgcat
gtcgcgatcaccgccgagcggctcaacgcccatggcatcggcaagggcgatcgcgtcgcg
ctccagttgcccaactccgccgacgcggccgtgctgatgctcgcgacgctcatggcaggc
gcgatacccgttcccatcttgccggcctaccgcgagcgggaacttcgacacattctgaag
accactcgcccgcgcgccatcgcgttgacccggggcagccgccgcttcagcccgcttcag
acagtggtcggcctgctctccgaagaaggtctggaagtcgaccttctgttggccgacggc
ccttcccgcgccgacgatcgtccggaatggctggatctccggcaattctgcctggcgccc
gccgactcgatgccgcgcgaactgcgcccggtcgacatgcgcgccgacgacaccgcgatg
atgctgctgtccagcggtacgaccggcttgccgaaggccatcgcaagacggaacgccgga
tacggatacatgatcgccgaaggctgcaaggtgttcgagctcagccgttcagccgtctat
ctggccgccttgccgctctcgcacggcttcgtgatcaactgtccgggcattctcggaacg
cttgcttgcggcggaacagtggtcttggcggcggacgcttccgcacaaacctctctgaag
ctcatcggcgcgcacggcgtcactcacaccacgctggtccccgcgctcttgacgcaatgg
atggagcgcgcggacgaatcgcgagccggttcaggcacgctgaggtacgtgcaggtgggc
gggtcgcgattacccgccgatctcgcggcgcaggccgaatcccggctgggggtgcgcatc
cagcagtgctacggcatgagcgagggactgctttgcttcacccgcttcaccgatcccgac
gcgatccgcttcaactcccaggggcgcccgctttcggacgccgacgagatcctcatcgtc
aatgatcgggacgaaccgcttccctacggccaatcgggcgagttgctcacccgcggccct
tacaccatcgaacagtatttcaacgatccggacgcttcgcgccgagcattcacgccgaac
ggctactaccgcacgggagacgtcgcccatctcgatgcggcgggcaacgtctatatcgac
gggcgcgtcacggacaccatcaatcgcggcggcgaaaaattctgcccggaagaactcgag
gcgttgatgaagcggcacgccaaattgaaggacgccgcttgcgtcggcatgcctgacggc
cgcttcggcgaggtttcctgcctgttcgccgtcgcacgcgacggtgaacaggtgtcgctc
gcggaactccggaggcatctggaagccgccggagtcgccgcgttcaaactgccggaacag
ttggtgctgatcgacgagatccccagaaaaggcatcggcaagatcgatcgcgccgcgttg
cgagcaagcgcccgcgcgaacgcaccggccgtcgcggccgcttgccggacgggacaagta
tga

DBGET integrated database retrieval system