Bacillus subtilis subsp. natto BEST195: BSNT_06747 Help Entry BSNT_06747        CDS       T02607                                  Symbol ycsD Name (GenBank) hypothetical protein   KO K02372   3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59] Organism bso  Bacillus subtilis subsp. natto BEST195 Pathway bso00061   Fatty acid biosynthesis bso00780   Biotin metabolism bso01100   Metabolic pathways bso01212   Fatty acid metabolism bso01240   Biosynthesis of cofactors Module bso_M00083   Fatty acid biosynthesis, elongation Brite KEGG Orthology (KO) [BR:bso00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BSNT_06747 (ycsD)   09108 Metabolism of cofactors and vitamins    00780 Biotin metabolism     BSNT_06747 (ycsD)  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:bso01004]     BSNT_06747 (ycsD) Enzymes [BR:bso01000]  4. Lyases   4.2  Carbon-oxygen lyases    4.2.1  Hydro-lyases     4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase      BSNT_06747 (ycsD) Lipid biosynthesis proteins [BR:bso01004]  Fatty acid synthase   Component type    BSNT_06747 (ycsD) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FabA Motif Other DBs NCBI-ProteinID:  BAI83884 UniProt:  D4G578 LinkDB All DBs Position 453131..453487 Genome browser AA seq 118 aa AA seqDB search MFIDGVTDSEPGKHAAAYKLISENDWFITDTQTEMPFSLVIEALAQTAAFTGITDENSLG LLSSVKKAEKLGEAVPGDRLDLTFEVTRNRRGFVFGHAKASVGEQPVAEAEIGIYIEK NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atgtttattgatggcgtgacggatagcgagcccggcaaacatgcggcagcttataagctg attagtgagaacgattggtttattactgatacgcaaacagaaatgccgttttcacttgtg attgaagcgcttgcgcaaaccgcggcttttacaggaattacagatgagaacagcttggga ttattgtcttcggtgaagaaagcggaaaagctgggagaagctgtgcctggtgaccggctt gatcttacgtttgaagtcacgcgcaatcggcgcgggtttgtgttcggacatgccaaggca tcagttggagagcagcctgttgctgaagctgaaatcggcatctatattgaaaaatga

DBGET integrated database retrieval system