Betta splendens (Siamese fighting fish): 114854770 Help Entry 114854770         CDS       T08231                                  Symbol pole4 Name (RefSeq) DNA polymerase epsilon subunit 4   KO K03506   DNA polymerase epsilon subunit 4 [EC:2.7.7.7] Organism bspl  Betta splendens (Siamese fighting fish) Pathway bspl03030   DNA replication bspl03410   Base excision repair bspl03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:bspl00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     114854770 (pole4)    03410 Base excision repair     114854770 (pole4)    03420 Nucleotide excision repair     114854770 (pole4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bspl03032]     114854770 (pole4)    03400 DNA repair and recombination proteins [BR:bspl03400]     114854770 (pole4) Enzymes [BR:bspl01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      114854770 (pole4) DNA replication proteins [BR:bspl03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     114854770 (pole4) DNA repair and recombination proteins [BR:bspl03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       114854770 (pole4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C TAF TFIID-31kDa Motif Other DBs NCBI-GeneID:  114854770 NCBI-ProteinID:  XP_029005285 UniProt:  A0A6P7MFE6 LinkDB All DBs Position 4:complement(6738125..6739602) Genome browser AA seq 129 aa AA seqDB search MAATVVTAAVPTEHDSDRCGSEEENRGAEAAEESRQQQTGPAAAATHNRLSKLPLARIKA LMKSDPDVSLASQESVFIIAKATELFVEMIAKDALVYAQQGKRKTLQRKDLDNAIEAIDE FAFLEGTLD NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atggcagctacggttgtaacggctgctgtccccacggagcacgactctgaccggtgtgga agcgaggaggagaaccgcggtgccgaggcggcggaggagagccgccagcagcagacaggc ccggcggccgccgcgacccacaaccgcctgtccaagctgccgctggcccgcatcaaggcg ctgatgaagagcgaccccgacgtgtcgctcgccagccaggagtctgtgttcatcatcgcc aaagccacggagttgtttgtggagatgattgccaaagatgcccttgtgtacgcccaacaa gggaagaggaaaacattgcaaagaaaggatctggacaatgcaatagaggccatagacgag tttgcatttcttgaaggcacactggattaa

DBGET integrated database retrieval system