Betta splendens (Siamese fighting fish): 114857859 Help Entry 114857859         CDS       T08231                                  Symbol tmem258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism bspl  Betta splendens (Siamese fighting fish) Pathway bspl00510   N-Glycan biosynthesis bspl00513   Various types of N-glycan biosynthesis bspl04141   Protein processing in endoplasmic reticulum Module bspl_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:bspl00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     114857859 (tmem258)    00513 Various types of N-glycan biosynthesis     114857859 (tmem258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     114857859 (tmem258) SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 TctB Motif Other DBs NCBI-GeneID:  114857859 NCBI-ProteinID:  XP_029010592 UniProt:  A0A6P7MUH5 LinkDB All DBs Position 6 Genome browser AA seq 90 aa AA seqDB search MTGSGAPLQSKMELEAMTRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRD VYKELLISLVASLFMGFGVLFLLLWVGIYV NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgacaggcagtggagctcctctgcaatctaaaatggaactcgaggccatgaccagatac accagcccggtgaatccggctgtgttcccccatctgactgtggtgctgctggccatcggc atgttcttcaccgcctggttcttcgtctatgaagtaacttcaacaaaatacacaagggat gtctacaaagagctgctgatatccctcgtagcttcactgtttatgggttttggtgtcctc ttcttgctactctgggttggcatctatgtataa

DBGET integrated database retrieval system