Betta splendens (Siamese fighting fish): 114864312 Help Entry 114864312         CDS       T08231                                  Symbol ran Name (RefSeq) GTP-binding nuclear protein Ran   KO K07936   GTP-binding nuclear protein Ran Organism bspl  Betta splendens (Siamese fighting fish) Pathway bspl03008   Ribosome biogenesis in eukaryotes bspl03013   Nucleocytoplasmic transport bspl03250   Viral life cycle - HIV-1 Brite KEGG Orthology (KO) [BR:bspl00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     114864312 (ran)    03008 Ribosome biogenesis in eukaryotes     114864312 (ran)   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     114864312 (ran)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:bspl03019]     114864312 (ran)    03009 Ribosome biogenesis [BR:bspl03009]     114864312 (ran)    03016 Transfer RNA biogenesis [BR:bspl03016]     114864312 (ran)    03036 Chromosome and associated proteins [BR:bspl03036]     114864312 (ran)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bspl04147]     114864312 (ran)    04031 GTP-binding proteins [BR:bspl04031]     114864312 (ran) Messenger RNA biogenesis [BR:bspl03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      114864312 (ran) Ribosome biogenesis [BR:bspl03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     114864312 (ran)   Pre-60S particles     114864312 (ran) Transfer RNA biogenesis [BR:bspl03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     114864312 (ran) Chromosome and associated proteins [BR:bspl03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      114864312 (ran)    Spindle formation proteins     114864312 (ran) Exosome [BR:bspl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114864312 (ran) GTP-binding proteins [BR:bspl04031]  Small (monomeric) G-proteins   Ran Family    Ran     114864312 (ran) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RNA_helicase AAA_24 ArgoMid Pox_A32 AAA_7 DUF5906 TsaE AAA_22 AAA_16 Motif Other DBs NCBI-GeneID:  114864312 NCBI-ProteinID:  XP_029020904 UniProt:  A0A6P7NSA3 LinkDB All DBs Position 10:complement(13377715..13380727) Genome browser AA seq 215 aa AA seqDB search MAQCVPVAVFKLVLVGDGGTGKTTFVKRHITGEFEKKYVATLGVEVHPLMFHTNRGAIKY NVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCG NKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPA LAPPEVLMDPSLAAKYEEELQVASNTALPDEEDDL NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggcacagtgtgtaccggtggcggtgtttaagctggtgttagtaggagatggaggcacc ggtaaaacgacttttgtgaaacggcacatcacaggagagtttgagaagaaatatgttgct actctgggagtagaggtgcatccattgatgttccacacaaatagaggagccatcaagtac aatgtgtgggacacagctggtcaggagaagtttggaggtctgagagatggctactacatt caagctcagtgtgctatcatcatgtttgatgtcacttcacgagtcacttataagaacgta cccaactggcatcgtgatctggtccgtgtctgtgagaacattcccattgtcctctgtggc aacaaggtggacatcaaagacaggaaagtcaaagcaaagagcattgtgtttcaccgcaag aagaacctgcagtactatgacatttccgccaagagtaactacaactttgagaagcctttc ctgtggttagcaaggaagttgattggtgatcccaacctggaatttgtggcaatgcctgct ctcgctcccccagaggtcctaatggacccaagccttgctgctaagtatgaggaagaactt caagttgcatcaaatacagcactcccagatgaagaagatgacctctaa

DBGET integrated database retrieval system