Betta splendens (Siamese fighting fish): 114864821 Help Entry 114864821         CDS       T08231                                  Symbol tmsb2 Name (RefSeq) thymosin beta-12   KO K05764   thymosin, beta 4 Organism bspl  Betta splendens (Siamese fighting fish) Pathway bspl04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:bspl00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     114864821 (tmsb2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:bspl04812]     114864821 (tmsb2) Cytoskeleton proteins [BR:bspl04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Thymosin      114864821 (tmsb2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thymosin DUF4522 Motif Other DBs NCBI-GeneID:  114864821 NCBI-ProteinID:  XP_029021625 UniProt:  A0A6P7NUC8 LinkDB All DBs Position 10:7930303..7932205 Genome browser AA seq 45 aa AA seqDB search MSDKPDMAEIARFDKTKLKKTETKEKNPLPTKETIEQERKGDATP NT seq 138 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaagcccgacatggccgagatcgcccgcttcgacaagaccaagctgaagaag acggagacaaaagagaagaaccctctgcccaccaaagagaccatcgagcaggagaggaaa ggcgacgccacaccttga

DBGET integrated database retrieval system