KEGG   Bacillus subtilis subsp. subtilis 168: BSU00900
Entry
BSU00900          CDS       T00010                                 
Symbol
ispD
Name
(RefSeq) 2-D-methyl-D-erythritol 4-phosphate cytidylyltransferase
  KO
K00991  2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [EC:2.7.7.60]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00900  Terpenoid backbone biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Module
bsu_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSU00900 (ispD)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.60  2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
     BSU00900 (ispD)
SSDB
Motif
Pfam: IspD NTP_transf_3 NTP_transferase CTP_transf_3 DpaA_N
Other DBs
NCBI-GeneID: 936855
NCBI-ProteinID: NP_387971
Pasteur: BG10152
BSORF: BG10152
UniProt: Q06755 A0A6M4JHP8
Structure
LinkDB
Position
109789..110487
AA seq 232 aa
MSYDVVIPAAGQGKRMKAGRNKLFIELKGDPVIIHTLRVFDSHRQCDKIILVINEQEREH
FQQLLSDYPFQTSIELVAGGDERQHSVYKGLKAVKQEKIVLVHDGARPFIKHEQIDELIA
EAEQTGAAILAVPVKDTIKRVQDLQVSETIERSSLWAVQTPQAFRLSLLMKAHAEAERKG
FLGTDDASLVEQMEGGSVRVVEGSYTNIKLTTPDDLTSAEAIMESESGNKHV
NT seq 699 nt   +upstreamnt  +downstreamnt
atgagttatgatgtggtgattcctgcagccggacagggaaagcggatgaaggcagggaga
aataaactgttcattgagctgaagggagacccggtgatcatacacacgttaagagtgttt
gacagccaccggcagtgcgataaaatcattttggtgattaacgagcaggagcgggagcac
tttcagcaattgctgtccgattacccgtttcaaacttcaattgagcttgttgcaggcgga
gatgagcgacagcacagtgtgtataaggggctgaaagccgtaaagcaggaaaagattgtc
cttgtacatgacggtgcccgtccatttataaaacatgaacaaattgacgaactgatcgca
gaggcggaacagacaggagcggccatccttgctgttccggtaaaagatacgattaaacgc
gttcaagatttacaagtcagtgagacgattgaacgttcaagcttgtgggctgtccaaacg
ccacaagcttttcgtctttctttattgatgaaggctcacgctgaggccgagcgcaaggga
tttttagggacggatgacgccagcctcgttgaacagatggagggcggttcggtccgtgtt
gtagaaggcagctatacaaatattaagctgacgacgccagacgatttgacgtcagctgaa
gctatcatggaatcagaaagtgggaataaacatgtttag

DBGET integrated database retrieval system