Brucella suis bv. 2 Bs143CITA: BSSP1_I0672 Help Entry BSSP1_I0672       CDS       T03367                                  Name (GenBank) Dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism bsui  Brucella suis bv. 2 Bs143CITA Pathway bsui00790   Folate biosynthesis bsui01100   Metabolic pathways bsui01240   Biosynthesis of cofactors Module bsui_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:bsui00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     BSSP1_I0672 Enzymes [BR:bsui01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      BSSP1_I0672  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      BSSP1_I0672  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      BSSP1_I0672 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AIB27534 LinkDB All DBs Position I:complement(666456..666815) Genome browser AA seq 119 aa AA seqDB search MYTIRIMNCAFFAHHGVFDEEHKLGQRFYVDAVLDVDEGNSLESDNIDGTVHYGIAFSVI EGIIMGRQRYLIETLALDVAKALVARFPQIKRAEITVRKPNAPVSGVLDYVEVTVVYPQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt gtgtacacgatccgcatcatgaactgtgccttttttgcgcatcacggtgtcttcgatgaa gaacacaagctcggacaacgattctatgtcgatgccgttctggatgttgatgagggcaac tcgctggaaagcgacaatattgacggaacagttcattacggaattgccttctccgtcatt gaaggcatcatcatgggccgccagcgttatctgatcgaaaccctcgcgcttgatgtcgcc aaggcgctcgtcgcacggtttcctcagataaagcgggctgagatcacggtccgcaagccg aatgccccggtttcgggcgtcctcgattatgtggaagtaaccgtggtttacccccagtga

DBGET integrated database retrieval system