Bos taurus (cow): 112447878 Help Entry 112447878         CDS       T01008                                  Name (RefSeq) interferon beta-3   KO K05415   interferon beta Organism bta  Bos taurus (cow) Pathway bta04060   Cytokine-cytokine receptor interaction bta04151   PI3K-Akt signaling pathway bta04217   Necroptosis bta04380   Osteoclast differentiation bta04620   Toll-like receptor signaling pathway bta04621   NOD-like receptor signaling pathway bta04622   RIG-I-like receptor signaling pathway bta04623   Cytosolic DNA-sensing pathway bta04630   JAK-STAT signaling pathway bta04650   Natural killer cell mediated cytotoxicity bta04668   TNF signaling pathway bta04936   Alcoholic liver disease bta05135   Yersinia infection bta05142   Chagas disease bta05152   Tuberculosis bta05160   Hepatitis C bta05161   Hepatitis B bta05162   Measles bta05163   Human cytomegalovirus infection bta05164   Influenza A bta05165   Human papillomavirus infection bta05167   Kaposi sarcoma-associated herpesvirus infection bta05168   Herpes simplex virus 1 infection bta05169   Epstein-Barr virus infection bta05170   Human immunodeficiency virus 1 infection bta05171   Coronavirus disease - COVID-19 bta05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     112447878    04668 TNF signaling pathway     112447878    04151 PI3K-Akt signaling pathway     112447878   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112447878  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     112447878  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112447878    04621 NOD-like receptor signaling pathway     112447878    04622 RIG-I-like receptor signaling pathway     112447878    04623 Cytosolic DNA-sensing pathway     112447878    04650 Natural killer cell mediated cytotoxicity     112447878   09158 Development and regeneration    04380 Osteoclast differentiation     112447878  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     112447878    05161 Hepatitis B     112447878    05160 Hepatitis C     112447878    05171 Coronavirus disease - COVID-19     112447878    05164 Influenza A     112447878    05162 Measles     112447878    05168 Herpes simplex virus 1 infection     112447878    05163 Human cytomegalovirus infection     112447878    05167 Kaposi sarcoma-associated herpesvirus infection     112447878    05169 Epstein-Barr virus infection     112447878    05165 Human papillomavirus infection     112447878   09171 Infectious disease: bacterial    05135 Yersinia infection     112447878    05152 Tuberculosis     112447878   09174 Infectious disease: parasitic    05142 Chagas disease     112447878   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112447878   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     112447878  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bta04052]     112447878 Cytokines and neuropeptides [BR:bta04052]  Cytokines   Interferons    112447878 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  112447878 NCBI-ProteinID:  XP_059745359 Ensembl:  ENSBTAG00000055103 LinkDB All DBs Position 8:23198057..23200213 Genome browser AA seq 186 aa AA seqDB search MTYRCLLPMVLLLCFSTTALSRSYSLLRFQQRRSAEVCQKLLGQLHSTPQHCLEARMDFQ VPEEMNQAQQFRKEDAILVIYEMLQQIFNILTRDFSSTGWSETIIEDLLVELYGQMNRLQ PIQKEIMQEQNFTMGDTTVLHLKKYYFNLVQYLESKEYNRCAWTVVRVQILTNFSFLMRL TASLRD NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgacctaccggtgcctcctcccgatggttctcctgctgtgtttctccaccacagctctt tccaggagctacagcttgctccgattccagcaaaggcggagcgctgaggtgtgtcagaaa ctcctggggcagttacattcaacgcctcaacattgcctcgaggccaggatggacttccag gtccctgaggagatgaaccaagcacagcagttccggaaggaagatgccatattggtcatc tatgagatgctccagcagatcttcaatattctcaccagagacttctccagcactggctgg tctgagaccatcattgaggacctccttgtggaactctatgggcagatgaatcgtctgcag ccaatccagaaggaaataatgcaggagcaaaacttcaccatgggggacacaaccgttctt cacctgaagaagtattacttcaacctcgtgcagtacctggagtccaaggagtacaacagg tgtgcctggacagtcgtgcgagtgcaaatactcacgaacttttctttcctgatgagacta acagcttccctccgtgactga

DBGET integrated database retrieval system