Bos taurus (cow): 281845 Help Entry 281845            CDS       T01008                                  Symbol IFNB1 Name (RefSeq) interferon beta precursor   KO K05415   interferon beta Organism bta  Bos taurus (cow) Pathway bta04060   Cytokine-cytokine receptor interaction bta04151   PI3K-Akt signaling pathway bta04217   Necroptosis bta04380   Osteoclast differentiation bta04620   Toll-like receptor signaling pathway bta04621   NOD-like receptor signaling pathway bta04622   RIG-I-like receptor signaling pathway bta04623   Cytosolic DNA-sensing pathway bta04630   JAK-STAT signaling pathway bta04650   Natural killer cell mediated cytotoxicity bta04668   TNF signaling pathway bta04936   Alcoholic liver disease bta05135   Yersinia infection bta05142   Chagas disease bta05152   Tuberculosis bta05160   Hepatitis C bta05161   Hepatitis B bta05162   Measles bta05163   Human cytomegalovirus infection bta05164   Influenza A bta05165   Human papillomavirus infection bta05167   Kaposi sarcoma-associated herpesvirus infection bta05168   Herpes simplex virus 1 infection bta05169   Epstein-Barr virus infection bta05170   Human immunodeficiency virus 1 infection bta05171   Coronavirus disease - COVID-19 bta05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     281845 (IFNB1)    04668 TNF signaling pathway     281845 (IFNB1)    04151 PI3K-Akt signaling pathway     281845 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     281845 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     281845 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     281845 (IFNB1)    04621 NOD-like receptor signaling pathway     281845 (IFNB1)    04622 RIG-I-like receptor signaling pathway     281845 (IFNB1)    04623 Cytosolic DNA-sensing pathway     281845 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     281845 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     281845 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     281845 (IFNB1)    05161 Hepatitis B     281845 (IFNB1)    05160 Hepatitis C     281845 (IFNB1)    05171 Coronavirus disease - COVID-19     281845 (IFNB1)    05164 Influenza A     281845 (IFNB1)    05162 Measles     281845 (IFNB1)    05168 Herpes simplex virus 1 infection     281845 (IFNB1)    05163 Human cytomegalovirus infection     281845 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     281845 (IFNB1)    05169 Epstein-Barr virus infection     281845 (IFNB1)    05165 Human papillomavirus infection     281845 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     281845 (IFNB1)    05152 Tuberculosis     281845 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     281845 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     281845 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     281845 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bta04052]     281845 (IFNB1) Cytokines and neuropeptides [BR:bta04052]  Cytokines   Interferons    281845 (IFNB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  281845 NCBI-ProteinID:  NP_776775 BGD-bta:  BT10583 UniProt:  P01578 LinkDB All DBs Position 8:23263785..23264421 Genome browser AA seq 186 aa AA seqDB search MTYRCLLQMVLLLCFSTTALSRSYSLLRFQQRQSLKECQKLLGQLPSTSQHCLEARMDFQ MPEEMKQEQQFQKEDAILVMYEVLQHIFGILTRDFSSTGWSETIIEDLLKELYWQMNRLQ PIQKEIMQKQNSTTEDTIVPHLGKYYFNLMQYLESKEYDRCAWTVVQVQILTNVSFLMRL TGYVRD NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgacctaccggtgcctcctccagatggttctcctgctgtgtttctccaccacagctctt tccaggagctacagcttgcttcgattccaacaacgtcagagccttaaagagtgtcagaaa ctcctggggcagttaccttcaacttctcaacattgcctcgaggccaggatggacttccag atgcctgaggagatgaagcaagaacagcagttccagaaggaagatgccatattggtcatg tatgaggtgctccagcacatcttcggcattctcaccagagacttctccagcactggctgg tctgagaccatcatcgaggacctccttaaggaactctattggcagatgaatcgtctgcag ccaatccagaaggaaataatgcagaagcaaaactccactacggaagacacgatcgttccc cacctagggaaatattacttcaacctcatgcagtacctggagtccaaggagtacgacagg tgtgcctggacagtcgtgcaagtgcaaatactcacgaacgtttctttcctgatgagacta acaggttacgtccgtgactga

DBGET integrated database retrieval system