Bos taurus (cow): 327708 Help Entry 327708            CDS       T01008                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism bta  Bos taurus (cow) Pathway bta04010   MAPK signaling pathway bta04014   Ras signaling pathway bta04015   Rap1 signaling pathway bta04024   cAMP signaling pathway bta04062   Chemokine signaling pathway bta04510   Focal adhesion bta04517   IgSF CAM signaling bta04520   Adherens junction bta04611   Platelet activation bta04670   Leukocyte transendothelial migration bta04720   Long-term potentiation bta04722   Neurotrophin signaling pathway bta04934   Cushing syndrome bta04972   Pancreatic secretion bta05211   Renal cell carcinoma bta05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     327708 (RAP1B)    04014 Ras signaling pathway     327708 (RAP1B)    04015 Rap1 signaling pathway     327708 (RAP1B)    04024 cAMP signaling pathway     327708 (RAP1B)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     327708 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     327708 (RAP1B)    04520 Adherens junction     327708 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     327708 (RAP1B)    04670 Leukocyte transendothelial migration     327708 (RAP1B)    04062 Chemokine signaling pathway     327708 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     327708 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     327708 (RAP1B)    04722 Neurotrophin signaling pathway     327708 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     327708 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     327708 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     327708 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bta04147]     327708 (RAP1B)    04031 GTP-binding proteins [BR:bta04031]     327708 (RAP1B) Exosome [BR:bta04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    327708 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    327708 (RAP1B)   Exosomal proteins of colorectal cancer cells    327708 (RAP1B) GTP-binding proteins [BR:bta04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     327708 (RAP1B) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  327708 NCBI-ProteinID:  NP_787018 BGD-bta:  BT11248 Ensembl:  ENSBTAG00000008967 UniProt:  P61223 LinkDB All DBs Position 5 Genome browser AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagtcgttcttggctctggaggcgttggaaaatctgctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttat agaaagcaagttgaagtagatgcacagcagtgtatgcttgaaatcttggatactgcagga acggaacaattcacagcaatgagggatttgtacatgaaaaatggacaaggctttgcgtta gtttattccatcacagcacagtccacatttaatgatttacaagatctgagagaacagata cttcgagttaaagacacggatgatgttccaatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcaagacagtggaacaac tgtgcattcttagaatcctctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcgacaaattaacagaaaaactccagtgcctgggaaggcccgcaaaaagtcgtca tgtcagctgctttaa

DBGET integrated database retrieval system