Bos taurus (cow): 510618 Help Entry 510618            CDS       T01008                                  Symbol CDK4 Name (RefSeq) cyclin-dependent kinase 4   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism bta  Bos taurus (cow) Pathway bta01522   Endocrine resistance bta04110   Cell cycle bta04115   p53 signaling pathway bta04151   PI3K-Akt signaling pathway bta04218   Cellular senescence bta04530   Tight junction bta04660   T cell receptor signaling pathway bta04933   AGE-RAGE signaling pathway in diabetic complications bta04934   Cushing syndrome bta05160   Hepatitis C bta05162   Measles bta05163   Human cytomegalovirus infection bta05164   Influenza A bta05165   Human papillomavirus infection bta05166   Human T-cell leukemia virus 1 infection bta05167   Kaposi sarcoma-associated herpesvirus infection bta05169   Epstein-Barr virus infection bta05200   Pathways in cancer bta05203   Viral carcinogenesis bta05212   Pancreatic cancer bta05214   Glioma bta05218   Melanoma bta05219   Bladder cancer bta05220   Chronic myeloid leukemia bta05222   Small cell lung cancer bta05223   Non-small cell lung cancer bta05224   Breast cancer bta05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     510618 (CDK4)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     510618 (CDK4)    04115 p53 signaling pathway     510618 (CDK4)    04218 Cellular senescence     510618 (CDK4)   09144 Cellular community - eukaryotes    04530 Tight junction     510618 (CDK4)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     510618 (CDK4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     510618 (CDK4)    05203 Viral carcinogenesis     510618 (CDK4)   09162 Cancer: specific types    05212 Pancreatic cancer     510618 (CDK4)    05225 Hepatocellular carcinoma     510618 (CDK4)    05214 Glioma     510618 (CDK4)    05220 Chronic myeloid leukemia     510618 (CDK4)    05218 Melanoma     510618 (CDK4)    05219 Bladder cancer     510618 (CDK4)    05224 Breast cancer     510618 (CDK4)    05222 Small cell lung cancer     510618 (CDK4)    05223 Non-small cell lung cancer     510618 (CDK4)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     510618 (CDK4)    05160 Hepatitis C     510618 (CDK4)    05164 Influenza A     510618 (CDK4)    05162 Measles     510618 (CDK4)    05163 Human cytomegalovirus infection     510618 (CDK4)    05167 Kaposi sarcoma-associated herpesvirus infection     510618 (CDK4)    05169 Epstein-Barr virus infection     510618 (CDK4)    05165 Human papillomavirus infection     510618 (CDK4)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     510618 (CDK4)    04934 Cushing syndrome     510618 (CDK4)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     510618 (CDK4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:bta01001]     510618 (CDK4) Enzymes [BR:bta01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      510618 (CDK4) Protein kinases [BR:bta01001]  Serine/threonine kinases: CMGC group   CDK family    510618 (CDK4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kdo ABC1 Haspin_kinase Kinase-like Motif Other DBs NCBI-GeneID:  510618 NCBI-ProteinID:  NP_001032683 BGD-bta:  BT19276 Ensembl:  ENSBTAG00000007160 UniProt:  Q32KY4 LinkDB All DBs Position 5:55713431..55716418 Genome browser AA seq 303 aa AA seqDB search MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR DVSLPRGAFSPRGPRPVQSVVPELEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKAEG DAE NT seq 912 nt NT seq  +upstreamnt  +downstreamnt atggctacctcccgatatgagccagtggctgagattggtgtcggtgcctatgggacagtg tacaaggcccgtgatccccacagtggccactttgtggccctcaagagtgtaagagtcccc aatggaggaggtgctggagggggcctgcccatcagcaccgttcgggaggtggccttactg cggcgtctggaggcttttgagcatcccaatgttgtcaggcttatggacgtctgtgcaaca gcccgaactgaccgggagaccaaagtgaccctggtgtttgagcatgtggaccaagatctc aggacatatctggacaaggcacccccaccaggcttgccagtggagaccataaaagatctg atgcgccaatttctaagaggcctggatttccttcatgccaactgcatcgttcaccgagac ctgaagccagagaacattctggtgacaagtggtgggacagtcaagctggctgactttggc ctggccagaatctacagctaccagatggcacttacacctgtggttgttacactctggtat cgtgctccagaagttcttttgcagtctacgtatgcaacacccgtggacatgtggagcgtt ggctgtatctttgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagct gaccagttaggcaaaatctttgacctgattggactgcccccagaggatgactggccccga gatgtctctctaccccgaggagccttttccccccgagggccccgcccagtgcagtcggtg gtccctgagctggaggaatctggagcacagctgctgctggagatgctgacttttaaccca cacaagcgaatctctgccttccgagccctgcagcactcttatctacacaaggcagaaggt gacgcagagtga

DBGET integrated database retrieval system