Bos taurus (cow): 513266 Help Entry 513266            CDS       T01008                                  Symbol CD209 Name (RefSeq) CD209 antigen   KO K06563   C-type lectin domain family 4 member L/M Organism bta  Bos taurus (cow) Pathway bta03260   Virion - Human immunodeficiency virus bta03264   Virion - Flavivirus and Alphavirus bta03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus bta03273   Virion - Lassa virus and SFTS virus bta04145   Phagosome bta04625   C-type lectin receptor signaling pathway bta05152   Tuberculosis bta05162   Measles Brite KEGG Orthology (KO) [BR:bta00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     513266 (CD209)    03264 Virion - Flavivirus and Alphavirus     513266 (CD209)    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     513266 (CD209)    03273 Virion - Lassa virus and SFTS virus     513266 (CD209)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     513266 (CD209)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     513266 (CD209)  09160 Human Diseases   09172 Infectious disease: viral    05162 Measles     513266 (CD209)   09171 Infectious disease: bacterial    05152 Tuberculosis     513266 (CD209)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bta04131]     513266 (CD209)   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:bta04054]     513266 (CD209)    04515 Cell adhesion molecules [BR:bta04515]     513266 (CD209)    04090 CD molecules [BR:bta04090]     513266 (CD209)    04091 Lectins [BR:bta04091]     513266 (CD209) Membrane trafficking [BR:bta04131]  Endocytosis   Phagocytosis    C-lectin receptors     513266 (CD209) Pattern recognition receptors [BR:bta04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    513266 (CD209) Cell adhesion molecules [BR:bta04515]  Lectins   Selectins and C-type lectins    513266 (CD209) CD molecules [BR:bta04090]  Proteins   513266 (CD209) Lectins [BR:bta04091]  C-Type lectins   Asialoglycoprotein and DC receptors    513266 (CD209) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Lectin_C DUF4411 Motif Other DBs NCBI-GeneID:  513266 NCBI-ProteinID:  NP_001139228 BGD-bta:  BT14572 Ensembl:  ENSBTAG00000007312 UniProt:  C0IP18 LinkDB All DBs Position 7:complement(16586871..16589774) Genome browser AA seq 259 aa AA seqDB search MAEMYEHKEPDDSEEETFGGQRLAERHPRPLHSLRSLSECLTWGPLLLLLLLFVSLGFFT LQLTTLVQVSRIQCLQRDSGDRENNSLDKWLDTRFRSLTEVAEKQMQSNLEKILQRLTRM NATLAGLCHPCPQNWEFFDGSCYFFSWTQSDWRSAVSACLLIGAHLVIIESTEEEKFLNF WYPRNNKPTWIGLSDHHSEGSWRWVDDSPVQLSFWKKGEPNNHGDEDCVELHNDGWNDGR CVTENPWICEKPSVPCPVL NT seq 780 nt NT seq  +upstreamnt  +downstreamnt atggcagagatgtatgaacacaaggagccagatgactctgaggaggagacatttgggggc cagagactggctgagagacaccctcgaccactacacagtttgaggagcttgtcagagtgt ctgacctggggccctctgcttctcctgctgctcctcttcgtctcactgggcttcttcacg ctccagctgaccactctggttcaagtttccaggatccagtgtctgcagagagattcggga gaccgtgagaacaacagcctggataagtggctggacaccaggttccggagtctgactgaa gttgcagagaagcagatgcaatcaaacctggagaagatcctacagcgcctgacccggatg aatgccaccctggctggcctgtgccatccttgtcctcagaattgggagtttttcgatgga agctgctacttcttctcctggacccagagtgactggagatctgccgtctctgcctgtctg cttattggggcccacctagttatcatcgagagtactgaggaggagaaattcctgaacttt tggtatcccagaaataataaacccacctggatcggcctcagtgaccaccacagtgagggt tcctggcggtgggtggatgacagtcctgtccaactcagcttctggaaaaaaggggagccc aacaaccacggagatgaggactgtgtggaactgcacaacgatggctggaatgatggcaga tgtgttacagaaaacccctggatctgtgagaagccctcggttccctgcccagtcctctga

DBGET integrated database retrieval system