Bos taurus (cow): 618946 Help Entry 618946            CDS       T01008                                  Symbol IFNB3 Name (RefSeq) interferon beta-3 precursor   KO K05415   interferon beta Organism bta  Bos taurus (cow) Pathway bta04060   Cytokine-cytokine receptor interaction bta04151   PI3K-Akt signaling pathway bta04217   Necroptosis bta04380   Osteoclast differentiation bta04620   Toll-like receptor signaling pathway bta04621   NOD-like receptor signaling pathway bta04622   RIG-I-like receptor signaling pathway bta04623   Cytosolic DNA-sensing pathway bta04630   JAK-STAT signaling pathway bta04650   Natural killer cell mediated cytotoxicity bta04668   TNF signaling pathway bta04936   Alcoholic liver disease bta05135   Yersinia infection bta05142   Chagas disease bta05152   Tuberculosis bta05160   Hepatitis C bta05161   Hepatitis B bta05162   Measles bta05163   Human cytomegalovirus infection bta05164   Influenza A bta05165   Human papillomavirus infection bta05167   Kaposi sarcoma-associated herpesvirus infection bta05168   Herpes simplex virus 1 infection bta05169   Epstein-Barr virus infection bta05170   Human immunodeficiency virus 1 infection bta05171   Coronavirus disease - COVID-19 bta05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     618946 (IFNB3)    04668 TNF signaling pathway     618946 (IFNB3)    04151 PI3K-Akt signaling pathway     618946 (IFNB3)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     618946 (IFNB3)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     618946 (IFNB3)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     618946 (IFNB3)    04621 NOD-like receptor signaling pathway     618946 (IFNB3)    04622 RIG-I-like receptor signaling pathway     618946 (IFNB3)    04623 Cytosolic DNA-sensing pathway     618946 (IFNB3)    04650 Natural killer cell mediated cytotoxicity     618946 (IFNB3)   09158 Development and regeneration    04380 Osteoclast differentiation     618946 (IFNB3)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     618946 (IFNB3)    05161 Hepatitis B     618946 (IFNB3)    05160 Hepatitis C     618946 (IFNB3)    05171 Coronavirus disease - COVID-19     618946 (IFNB3)    05164 Influenza A     618946 (IFNB3)    05162 Measles     618946 (IFNB3)    05168 Herpes simplex virus 1 infection     618946 (IFNB3)    05163 Human cytomegalovirus infection     618946 (IFNB3)    05167 Kaposi sarcoma-associated herpesvirus infection     618946 (IFNB3)    05169 Epstein-Barr virus infection     618946 (IFNB3)    05165 Human papillomavirus infection     618946 (IFNB3)   09171 Infectious disease: bacterial    05135 Yersinia infection     618946 (IFNB3)    05152 Tuberculosis     618946 (IFNB3)   09174 Infectious disease: parasitic    05142 Chagas disease     618946 (IFNB3)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     618946 (IFNB3)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     618946 (IFNB3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bta04052]     618946 (IFNB3) Cytokines and neuropeptides [BR:bta04052]  Cytokines   Interferons    618946 (IFNB3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  618946 NCBI-ProteinID:  NP_001107769 UniProt:  P01577 LinkDB All DBs Position 8:23188148..23188785 Genome browser AA seq 186 aa AA seqDB search MTYRCLLPMVLLLCFSTTALSRSYSLLRFQQRRSAEVCQKLLGQLHSTPQHCLEAKMDFQ VPEEMNQAQQFRKEDAILVIYEMLQQIFNILTRDFSSTGWSETIIEDLLVELYGQMNRLQ PIQKEIMQEQNFTMGDTTVLHLKKYYFNLVQYLESKEYNRCAWTVVRVQILTNFSFLMRL TASLRD NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgacctaccggtgcctcctcccgatggttctcctgctgtgtttctccaccacagctctt tccaggagctacagcttgctcagattccagcaaaggcggagcgctgaggtgtgtcagaaa ctcctggggcagttacattcaacgcctcaacattgcctcgaggccaagatggacttccaa gtccctgaggagatgaaccaagcacagcagttccggaaggaagatgccatattggtcatc tatgagatgctccagcagatcttcaatattctcaccagagacttctccagcactggctgg tctgagaccatcattgaggacctccttgtggaactctatgggcagatgaatcgtctgcag ccaatccagaaggaaataatgcaggagcaaaacttcaccatgggggacacaaccgttctt cacctgaagaagtattacttcaacctcgtgcagtacctggagtccaaggagtacaacagg tgtgcctggacagtcgtgcgagtgcaaatactcacgaacttttctttcctgatgagacta acagcttccctccgtgactga

DBGET integrated database retrieval system