Bos taurus (cow): 786258 Help Entry 786258            CDS       T01008                                  Name (RefSeq) GTP-binding nuclear protein Ran   KO K07936   GTP-binding nuclear protein Ran Organism bta  Bos taurus (cow) Pathway bta03008   Ribosome biogenesis in eukaryotes bta03013   Nucleocytoplasmic transport bta03250   Viral life cycle - HIV-1 bta05166   Human T-cell leukemia virus 1 infection Brite KEGG Orthology (KO) [BR:bta00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     786258    03008 Ribosome biogenesis in eukaryotes     786258   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     786258  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     786258  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:bta03019]     786258    03009 Ribosome biogenesis [BR:bta03009]     786258    03016 Transfer RNA biogenesis [BR:bta03016]     786258    03036 Chromosome and associated proteins [BR:bta03036]     786258   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bta04147]     786258    04031 GTP-binding proteins [BR:bta04031]     786258 Messenger RNA biogenesis [BR:bta03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      786258 Ribosome biogenesis [BR:bta03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     786258   Pre-60S particles     786258 Transfer RNA biogenesis [BR:bta03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     786258 Chromosome and associated proteins [BR:bta03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      786258    Spindle formation proteins     786258 Exosome [BR:bta04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    786258 GTP-binding proteins [BR:bta04031]  Small (monomeric) G-proteins   Ran Family    Ran     786258 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Motif Other DBs NCBI-GeneID:  786258 NCBI-ProteinID:  XP_010820016 BGD-bta:  BT15288 LinkDB All DBs Position X:52205208..52205981 Genome browser AA seq 128 aa AA seqDB search MFDVTSRVTYKNVPNWHRDLVQVCENIPIVLCGNKVDIKDRKVKAKSIVFHQKKNLQYYD ISAKSNYNFEKPFLWLARKLIGDPNLEFVNMPALAPPEVVMDPALAAQYEHNLEVAQTTA LPDEDDDL NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgtttgatgtaacatcaagagttacttacaagaatgtgcctaactggcatagagatctg gtacaagtgtgtgagaacatcccaattgtgttgtgtggcaacaaagtggatattaaggac agaaaggttaaggcaaagtcaattgtcttccaccaaaagaagaatcttcagtactatgac atttctgccaaaagtaactacaactttgaaaagcccttcctctggcttgctagaaaactg attggagaccctaacttggagtttgtcaacatgcctgctcttgccccaccagaggtggtc atggacccagccttggcagcacagtatgagcacaatttagaggttgctcagacaactgct ctcccggatgaagatgatgacctgtga

DBGET integrated database retrieval system