Bos taurus (cow): 789148 Help Entry 789148            CDS       T01008                                  Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism bta  Bos taurus (cow) Pathway bta04010   MAPK signaling pathway bta04014   Ras signaling pathway bta04015   Rap1 signaling pathway bta04024   cAMP signaling pathway bta04062   Chemokine signaling pathway bta04510   Focal adhesion bta04520   Adherens junction bta04611   Platelet activation bta04670   Leukocyte transendothelial migration bta04720   Long-term potentiation bta04722   Neurotrophin signaling pathway bta04934   Cushing syndrome bta04972   Pancreatic secretion bta05211   Renal cell carcinoma bta05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     789148    04014 Ras signaling pathway     789148    04015 Rap1 signaling pathway     789148    04024 cAMP signaling pathway     789148  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     789148    04520 Adherens junction     789148  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     789148    04670 Leukocyte transendothelial migration     789148    04062 Chemokine signaling pathway     789148   09154 Digestive system    04972 Pancreatic secretion     789148   09156 Nervous system    04720 Long-term potentiation     789148    04722 Neurotrophin signaling pathway     789148  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     789148   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     789148   09167 Endocrine and metabolic disease    04934 Cushing syndrome     789148  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bta04147]     789148    04031 GTP-binding proteins [BR:bta04031]     789148 Exosome [BR:bta04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    789148   Exosomal proteins of other body fluids (saliva and urine)    789148   Exosomal proteins of colorectal cancer cells    789148 GTP-binding proteins [BR:bta04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     789148 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU G-alpha MMR_HSR1 Motif Other DBs NCBI-GeneID:  789148 NCBI-ProteinID:  XP_010805377 BGD-bta:  BT19403 Ensembl:  ENSBTAG00000025445 UniProt:  A0AAA9SVR8 LinkDB All DBs Position 7:complement(21533027..21534920) Genome browser AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGSKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLARQINRKTPVPGKAHKKSS CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagtcgttcttggctcgggaggcgttggaaaatctgctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttat agaaagcaagttgaagtagatgcacagcagtgtatgcttgaaatcttggatactgcagga acggaacaattcacagcaatgagggatttgtacatgaaaaatggacaaggctttgcgtta gtttattccatcacagcacagtccacatttaatgatttacaagatctgagagaacagatt cttcgagttaaagacacagatgatgttccaatgattctggttggtagtaagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcaagacagtggaacaac tgtgcattcttagaatcctctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagcgcgacaaattaacagaaaaactccagtgcctgggaaagcccacaaaaagtcgtca tgtcagctgctttaa

DBGET integrated database retrieval system