Bemisia tabaci (sweet potato whitefly): 109044484 Help Entry 109044484         CDS       T06019                                  Name (RefSeq) RING-box protein 1A   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism btab  Bemisia tabaci (sweet potato whitefly) Pathway btab03420   Nucleotide excision repair btab04120   Ubiquitin mediated proteolysis btab04141   Protein processing in endoplasmic reticulum btab04310   Wnt signaling pathway btab04341   Hedgehog signaling pathway - fly btab04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:btab00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     109044484    04120 Ubiquitin mediated proteolysis     109044484   09124 Replication and repair    03420 Nucleotide excision repair     109044484  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     109044484    04341 Hedgehog signaling pathway - fly     109044484    04350 TGF-beta signaling pathway     109044484  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:btab04121]     109044484    03400 DNA repair and recombination proteins [BR:btab03400]     109044484 Enzymes [BR:btab01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      109044484 Ubiquitin system [BR:btab04121]  Ubiquitin ligases (E3)   UBL E3 ligases    109044484   Multi subunit type E3    SCF complex     Ring finger protein      109044484    Cul2 complex      109044484    Cul3 complex      109044484    Cul4 complex      109044484    Cul7 complex      109044484    Cul8 complex      109044484    Cul9 complex      109044484 DNA repair and recombination proteins [BR:btab03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       109044484     TCR (transcription coupled repair) factors      Cul4-CSA complex       109044484 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  109044484 NCBI-ProteinID:  XP_018917769 UniProt:  A0A9P0ALJ7 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MAAASAMDVDDDDEVELPTSSSSKGEKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDL CIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggcagcagcttcagctatggacgtggacgatgatgatgaggtcgaattgccaacatcg agtagcagcaaaggtgagaagaaacggttcgaggtgaagaagtggaacgctgttgccttg tgggcgtgggacattgtcgtcgacaactgtgccatctgtcgtaaccacatcatggatctt tgcatcgaatgccaagccaatcaagcttccgccaccagtgaagaatgcacagtcgcctgg ggtgtctgtaaccacgcttttcattttcactgcatttcccgatggctcaaaacgcgacag gtgtgtcctctcgataatcgggagtgggagttccagaagtatggtcactaa

DBGET integrated database retrieval system