Budorcas taxicolor (takin): 128043956 Help Entry 128043956         CDS       T08909                                  Symbol ACTB Name (RefSeq) actin, cytoplasmic 1   KO K05692   actin beta/gamma 1 Organism btax  Budorcas taxicolor (takin) Pathway btax03082   ATP-dependent chromatin remodeling btax04015   Rap1 signaling pathway btax04145   Phagosome btax04210   Apoptosis btax04390   Hippo signaling pathway btax04510   Focal adhesion btax04520   Adherens junction btax04530   Tight junction btax04611   Platelet activation btax04613   Neutrophil extracellular trap formation btax04670   Leukocyte transendothelial migration btax04714   Thermogenesis btax04810   Regulation of actin cytoskeleton btax04814   Motor proteins btax04820   Cytoskeleton in muscle cells btax04919   Thyroid hormone signaling pathway btax04921   Oxytocin signaling pathway btax04971   Gastric acid secretion btax05014   Amyotrophic lateral sclerosis btax05100   Bacterial invasion of epithelial cells btax05132   Salmonella infection btax05135   Yersinia infection btax05164   Influenza A btax05205   Proteoglycans in cancer btax05225   Hepatocellular carcinoma btax05410   Hypertrophic cardiomyopathy btax05412   Arrhythmogenic right ventricular cardiomyopathy btax05414   Dilated cardiomyopathy btax05416   Viral myocarditis btax05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:btax00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     128043956 (ACTB)  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     128043956 (ACTB)    04390 Hippo signaling pathway     128043956 (ACTB)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     128043956 (ACTB)   09143 Cell growth and death    04210 Apoptosis     128043956 (ACTB)   09144 Cellular community - eukaryotes    04510 Focal adhesion     128043956 (ACTB)    04520 Adherens junction     128043956 (ACTB)    04530 Tight junction     128043956 (ACTB)   09142 Cell motility    04814 Motor proteins     128043956 (ACTB)    04820 Cytoskeleton in muscle cells     128043956 (ACTB)    04810 Regulation of actin cytoskeleton     128043956 (ACTB)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     128043956 (ACTB)    04613 Neutrophil extracellular trap formation     128043956 (ACTB)    04670 Leukocyte transendothelial migration     128043956 (ACTB)   09152 Endocrine system    04921 Oxytocin signaling pathway     128043956 (ACTB)    04919 Thyroid hormone signaling pathway     128043956 (ACTB)   09154 Digestive system    04971 Gastric acid secretion     128043956 (ACTB)   09159 Environmental adaptation    04714 Thermogenesis     128043956 (ACTB)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     128043956 (ACTB)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     128043956 (ACTB)   09172 Infectious disease: viral    05164 Influenza A     128043956 (ACTB)   09171 Infectious disease: bacterial    05132 Salmonella infection     128043956 (ACTB)    05135 Yersinia infection     128043956 (ACTB)    05100 Bacterial invasion of epithelial cells     128043956 (ACTB)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     128043956 (ACTB)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     128043956 (ACTB)    05410 Hypertrophic cardiomyopathy     128043956 (ACTB)    05412 Arrhythmogenic right ventricular cardiomyopathy     128043956 (ACTB)    05414 Dilated cardiomyopathy     128043956 (ACTB)    05416 Viral myocarditis     128043956 (ACTB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:btax03021]     128043956 (ACTB)    03019 Messenger RNA biogenesis [BR:btax03019]     128043956 (ACTB)    03036 Chromosome and associated proteins [BR:btax03036]     128043956 (ACTB)    03029 Mitochondrial biogenesis [BR:btax03029]     128043956 (ACTB)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:btax04812]     128043956 (ACTB)    04147 Exosome [BR:btax04147]     128043956 (ACTB) Transcription machinery [BR:btax03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      128043956 (ACTB) Messenger RNA biogenesis [BR:btax03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      128043956 (ACTB) Chromosome and associated proteins [BR:btax03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      128043956 (ACTB)     NuA4 complex      128043956 (ACTB)   Chromatin remodeling factors    BAF complex     128043956 (ACTB)    PBAF complex     128043956 (ACTB)    GBAF(ncBAF) complex     128043956 (ACTB)    SWR1 complex     128043956 (ACTB) Mitochondrial biogenesis [BR:btax03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     128043956 (ACTB) Cytoskeleton proteins [BR:btax04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      128043956 (ACTB) Exosome [BR:btax04147]  Exosomal proteins   Proteins found in most exosomes    128043956 (ACTB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  128043956 NCBI-ProteinID:  XP_052492366 LinkDB All DBs Position 2:complement(4148670..4152046) Genome browser AA seq 375 aa AA seqDB search MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt atggatgatgatattgctgcgctcgtggtcgacaacggctccggcatgtgcaaggccggc ttcgcgggcgacgatgctccccgggccgtcttcccttccatcgtggggcgcccccggcac cagggcgtaatggtgggcatggggcagaaggactcctacgtgggggatgaggctcagagc aagagaggcatcctgaccctcaagtaccctattgagcacggcatcgtcaccaactgggac gacatggagaagatctggcaccacaccttctacaacgagctgcgtgtggcccctgaggag caccccgtgctgctgaccgaggcccccctgaaccccaaggccaaccgtgagaagatgacc cagatcatgtttgagaccttcaacacccctgccatgtacgtggccatccaggctgtgctg tccctgtacgcctctggccgcaccaccggcatcgtgatggactccggtgacggggtcacc cacacggtgcccatctacgaggggtacgccctcccccacgccatcctgcgtctggacctg gctggccgggacctgacggactacctcatgaagatcctcacggagcgtggctacagcttc accaccacggccgagcgggaaatcgtccgtgacatcaaggagaagctctgctacgtggcc ctggacttcgagcaggagatggccaccgcggcctccagctcctccctggagaagagctac gagctgccggacgggcaggtcatcaccatcggcaatgagcggttccgctgccctgaggct ctcttccagccttccttcctgggcatggaatcctgcggcattcacgaaactaccttcaat tccatcatgaagtgtgacgtcgacatccgcaaggacctctacgccaacacggtgctgtcc ggcgggaccaccatgtaccctggcatcgcagacaggatgcagaaagagatcactgccctg gcacccagcacgatgaagatcaagatcatcgcgccccctgagcgcaagtactccgtgtgg attggcggctccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcag gagtacgacgagtccggcccctccatcgtccaccgcaaatgcttctag

DBGET integrated database retrieval system