Budorcas taxicolor (takin): 128047462 Help Entry 128047462         CDS       T08909                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism btax  Budorcas taxicolor (takin) Pathway btax04010   MAPK signaling pathway btax04014   Ras signaling pathway btax04015   Rap1 signaling pathway btax04024   cAMP signaling pathway btax04062   Chemokine signaling pathway btax04510   Focal adhesion btax04520   Adherens junction btax04611   Platelet activation btax04670   Leukocyte transendothelial migration btax04720   Long-term potentiation btax04722   Neurotrophin signaling pathway btax04934   Cushing syndrome btax04972   Pancreatic secretion btax05211   Renal cell carcinoma btax05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:btax00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     128047462 (RAP1B)    04014 Ras signaling pathway     128047462 (RAP1B)    04015 Rap1 signaling pathway     128047462 (RAP1B)    04024 cAMP signaling pathway     128047462 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     128047462 (RAP1B)    04520 Adherens junction     128047462 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     128047462 (RAP1B)    04670 Leukocyte transendothelial migration     128047462 (RAP1B)    04062 Chemokine signaling pathway     128047462 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     128047462 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     128047462 (RAP1B)    04722 Neurotrophin signaling pathway     128047462 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     128047462 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     128047462 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     128047462 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:btax04147]     128047462 (RAP1B)    04031 GTP-binding proteins [BR:btax04031]     128047462 (RAP1B) Exosome [BR:btax04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    128047462 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    128047462 (RAP1B)   Exosomal proteins of colorectal cancer cells    128047462 (RAP1B) GTP-binding proteins [BR:btax04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     128047462 (RAP1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  128047462 NCBI-ProteinID:  XP_052495635 LinkDB All DBs Position 5:complement(89689649..89735932) Genome browser AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagtcgttcttggctcgggaggcgttggaaaatctgctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttat aggaagcaagttgaagtagatgcgcagcagtgtatgcttgaaatcttggatactgcagga acggaacaattcacggcaatgagggatttgtacatgaaaaatggacaaggctttgcatta gtttattccatcacagcacagtccacatttaatgatttacaagatctgagagaacagatt cttcgagttaaagacacggatgatgttccaatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcacgacagtggaacaac tgtgcattcttagaatcctctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcgacaaattaacagaaaaactccagtgcctgggaaggcccgcaaaaagtcgtca tgtcagctgctttaa

DBGET integrated database retrieval system